KEGG   Prochlorococcus marinus MIT 9313: PMT_1713Help
Entry
PMT_1713          CDS       T00143                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmt00001]
   00620 Pyruvate metabolism
    PMT_1713
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PMT_1713
   00680 Methane metabolism
    PMT_1713
Enzymes [BR:pmt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PMT_1713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
1813328..1816342
Genome map
AA seq 1004 aa AA seqDB search
MIMAKPESTSASMQQSSAQKTDCEQPRAIGEGQQAGRLLQNRLELVEDLWQTVLRSECPP
DQAERLLRLKQLSEPLALEGADENSASRAIVLLIQEMDLAEAITAARAFSLYFQLVNILE
QRIEEDSYLASMSSGKENNRQDKPYDPFAPPLATQTDPATFRELFERLRRLNVPPAQLET
LLQEMDIRLVFTAHPTEIVRHTVRHKQRKVASLLQQFQSDPTKSTSEKESLRLQLEEEIR
LWWRTDELHQFKPSVLDEVDYALHYFQQVLFDAMPQLRRRLITAMAESYPDVHIPQAAFC
TFGSWVGSDRDGNPSVTPEITWRTACYQRQLMLERYVNAVQKLRDQLSISMQWSQVSTPL
LESLEMDRLRFPEVYEERAARYRLEPYRLKLSYTLERLKLTQHRNQQLAEAGWQTPPEGL
NPSPNLINAGEALHYKSVAEFRSDLELIRNSLVSTDLSCEPLDTLLNQVHIFAFSLASLD
IRQESNRHSDALDELTRYLNLPKAYGDMAENERVQWLMEELQTRRPLIPSAVIWSPSTAE
TVAVFRMLHRLQEEFGSRICRTYVISMSHTVSDLLEVLLLAKEAGLVDPAAGHAELLVVP
LFETVEDLQRAPAVMEALLSSPVYRNLLPRVSEQVQPLQELMLGYSDSNKDSGFLSSNWE
IHQAQIALQDLANRQGVALRLFHGRGGSVGRGGGPAYQAILAQPSGTVRGRIKITEQGEV
LASKYSLPELALYNLETFTTAVLQNSLVTNQLDATPSWNQLMTRLAGRSREHYRALVHNN
PDLVAFFQQVTPIEEISKLQISSRPARRKSGAKDLSSLRAIPWVFGWTQSRFLLPSWFGV
GTALAAEVESDADQLDLLRRLHQRWPFFRMLISKVEMTLSKVDLDLAHHYMTSLGREDYR
EAFNRIFEIIETEYSLTRRLVLNITGQPRLLAADPALQLSVDLRNRTIVPLGFLQVALLR
KLRDQNRQPPMNDAGDGRTYSRSELLRGALLTINGIAAGMRNTG
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
atgatcatggccaaacctgagtccactagcgcatcgatgcagcagtcttccgcccaaaaa
actgattgcgaacaacccagagcaatcggagaagggcagcaggcaggacgcttactgcag
aaccgccttgaactggtggaagacctttggcaaacggtactacgcagcgaatgtccaccg
gatcaggcagaacgactacttcgactgaagcaactcagtgaacctttggcccttgaaggt
gcagatgagaacagtgccagcagagcaatcgtgctgttgatccaagagatggacctggca
gaagcgatcaccgcagcacgcgccttctccctctatttccaactggtgaatatcctcgaa
caacggatcgaggaagacagctacctcgcaagtatgtcctctggcaaagaaaacaaccgc
caagacaaaccctatgacccctttgctccaccgctcgccacgcagacagacccagccaca
ttcagggagctgttcgaacgacttcgccgtctcaacgtgccaccagctcagctggagacc
cttctacaggagatggatatccgcctagttttcactgctcatcccactgaaatcgtccgt
cataccgttcgccataagcaacgcaaggttgcaagcctgttgcagcagtttcaatcagat
ccaacaaaatcgacatctgagaaagaaagcctgagactgcagcttgaggaggagatcagg
ctctggtggcggaccgatgagcttcatcagttcaagccctccgttctggatgaggtggat
tacgccctccactatttccaacaggtgctttttgatgccatgccccagctacggcgtcgc
ctgatcactgcaatggccgagagctatccggacgtacacattccacaagctgccttctgc
acgtttggatcttgggttggatcagaccgagacggcaatccttccgttacgccagaaatc
acctggcgcaccgcctgttatcaacgtcagctgatgctggagcgctatgtcaatgccgtt
caaaaactccgtgatcaactcagcatctccatgcaatggagccaggtaagtactccactg
ttggagtcactggaaatggaccggcttcgattccccgaggtttacgaggaacgcgcagcc
cgctatcgactcgagccttatcgcctcaaactcagctacaccctggagaggttgaaactc
actcaacatcgcaaccagcaattggccgaagcaggctggcaaaccccaccagaaggccta
aaccccagccccaatctaattaatgcgggagaagcccttcactacaaatcagtagcagaa
ttccgcagcgacctagaactgatccgcaacagcctggtcagcacagatctgagctgtgag
cctctggataccctcttaaatcaggtccacatcttcgctttctcactagccagccttgac
atccgccaggagagcaatcgccatagcgatgctctcgacgaattaacccgctacctaaac
ctccctaaggcctatggcgacatggccgaaaatgagcgagtgcaatggttaatggaggaa
ctacagactcgccgccccctgatcccctctgccgttatctggtcgcccagtacagccgaa
acggtggccgtgtttcgcatgctgcaccgactgcaggaggaattcggcagccgaatctgc
cgcacatatgtgatctcaatgagtcacacagtttccgatctactcgaggtgctgctgcta
gccaaagaagccggcctcgtggatccggctgctggccatgccgaactgcttgtggtgccc
ctcttcgaaaccgtagaggatctccagcgggctccagcagtaatggaggcacttttgagt
tcacctgtctaccgcaatttgctccctcgtgtcagcgaacaggtccaacctctgcaggag
ctgatgcttggctattcggacagcaacaaagactccggatttctatccagcaattgggag
atccatcaagcccaaattgccctgcaagatctagctaaccgccagggtgtggctctgcgc
cttttccatggacgcggtggatctgttggcagaggaggtggccctgcctaccaagcaatc
cttgcccaaccaagcggaaccgtgcgcggccgaatcaagatcactgagcagggagaagta
ctggcatcgaaatacagcctgcccgagctagccctttacaacctagaaacattcacaacg
gctgtcctgcaaaacagtctggtaaccaaccagctagatgccaccccaagttggaatcaa
ctgatgaccagactggctggccgttcacgtgagcactatcgggccctcgtccacaacaac
cctgatctggtggccttcttccaacaggtcacgccgatcgaagaaatcagcaaattgcaa
atctccagccgtcctgctcgacgcaaaagcggcgccaaggacctctctagcctgagagcg
atcccctgggtatttggctggacgcaaagtcgattcctgctaccgagctggtttggcgtt
ggaacagccttagccgctgaagtcgaatcagacgctgaccagcttgaccttctacgcaga
ctgcaccaacgctggccattcttccgaatgctgatctccaaggtggagatgaccctttca
aaagtagacctagacctggcccatcactacatgactagccttggccgcgaagattaccgt
gaagcctttaaccgtatcttcgagatcatcgaaacggagtacagcctcacccgccggttg
gtcttaaacatcacaggacaacccaggttgctcgcggccgatcccgccctacagctatca
gtagatcttcgcaatcgcacgatcgtgccccttgggtttctgcaagtggccctgcttcgc
aagctgcgtgatcagaaccggcagccacccatgaacgatgctggcgatggtcgcacttac
agccgcagcgaactgctaagaggcgcactgctcaccattaacggcattgctgcaggcatg
cgcaacaccggttga

DBGET integrated database retrieval system