KEGG   Petrimonas mucosa: ING2E5A_1491Help
Entry
ING2E5A_1491      CDS       T04553                                 

Gene name
pdhC3
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pmuc  Petrimonas mucosa
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmuc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ING2E5A_1491 (pdhC3)
   00020 Citrate cycle (TCA cycle)
    ING2E5A_1491 (pdhC3)
   00620 Pyruvate metabolism
    ING2E5A_1491 (pdhC3)
Enzymes [BR:pmuc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ING2E5A_1491 (pdhC3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:1790940..1792049
Genome map
AA seq 369 aa AA seqDB search
MEERQLVRATPAARLLARRMNVLLTNVTGTGYKGRIHKEDVAGWNFQGKTHVSPLARRIA
EEHNIDLKGVRGTGHNGKIMKDDVLLLISDPVLKARLTRDSFAEATAAPKIQTGISKQLQ
IVQTEPKPGQPARVEEATASETVPLTMMRKVIAKRMSESYFSIPSFIQTWEIDMTELLDL
RKRLLEPIKEKTGKKLTVTDLISFAVVKTLMKHKYINASLNSEVTEITFHNYVNLGMAVG
MDEGLLVPVVKNADKMSLSELVVSLKDLTERTLNKKLLPDEQTGSTFTISNLGMYGVEHF
TAIINQPNAAILSVSSTKETLVVRNGEAVIRPIMKVSLTSDHRIIDGLTAAKFMTDLKQL
LENPLSLLI
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaagacaattagtaagggcaacccctgcggcgagattgctggccagacggatg
aatgtgttgctgacgaatgtgaccgggacaggttacaagggacggattcataaagaggat
gttgccggatggaatttccagggcaagactcatgtttcgccgcttgcacgtagaattgcc
gaggaacacaacatcgacctgaagggtgtcaggggcaccggacacaacggtaaaatcatg
aaggatgatgtgctgttactgatctccgatcccgtactgaaagcacggcttacgcgtgat
tcttttgccgaggctacggcagcgccgaaaatccagactggaatcagcaagcagctacag
atagtacagaccgaaccgaagcctggtcagccggccagggttgaagaggccacagcctcg
gagaccgttcccttgaccatgatgcgtaaagtgatagccaagcggatgtcggaaagctat
ttctcgatcccttcgtttatccagacttgggaaatcgatatgaccgaactgcttgatctg
cgcaaacggctattggaaccgataaaggagaaaaccggcaagaaactgaccgtcaccgat
ctgatctcgtttgccgtggtgaagacactgatgaagcacaagtatatcaatgcgagtttg
aatagcgaggttacggaaatcactttccacaactacgtgaacctgggaatggccgtaggg
atggatgagggattgctggtaccggtagtgaagaatgccgacaaaatgtcgctcagtgaa
ctggtcgtctcgctgaaggatctcaccgaacggactctcaacaagaaactgttgcccgac
gagcagaccggcagcacctttaccatcagtaatctgggcatgtatggtgtggagcatttc
acggcgatcatcaatcagcccaatgctgctatcttgagtgtttcatctacaaaggagacg
ctagtggtacgtaacggggaagcggtaatccgcccgataatgaaggtaagcctcacaagc
gatcaccggatcatcgacggactgacggcagccaaattcatgaccgatctgaagcaattg
cttgagaatccgctctcactattaatataa

DBGET integrated database retrieval system