KEGG   Prunus mume (Japanese apricot): 103326731Help
Entry
103326731         CDS       T03196                                 

Definition
(RefSeq) hexokinase-3
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
pmum00010  Glycolysis / Gluconeogenesis
pmum00051  Fructose and mannose metabolism
pmum00052  Galactose metabolism
pmum00500  Starch and sucrose metabolism
pmum00520  Amino sugar and nucleotide sugar metabolism
pmum01100  Metabolic pathways
pmum01110  Biosynthesis of secondary metabolites
pmum01200  Carbon metabolism
Module
pmum_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pmum_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pmum00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103326731
   00051 Fructose and mannose metabolism
    103326731
   00052 Galactose metabolism
    103326731
   00500 Starch and sucrose metabolism
    103326731
   00520 Amino sugar and nucleotide sugar metabolism
    103326731
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103326731
Enzymes [BR:pmum01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103326731
Membrane trafficking [BR:pmum04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103326731
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 103326731
NCBI-ProteinID: XP_008227191
LinkDB All DBs
Position
LG3
AA seq 508 aa AA seqDB search
MGKVAVGLAVGVAVAACAVATVVVGRRIRSRRKWRRVVGVLKELEQSCETTVGRLRQVVD
AMAVEMHAGLASDGGSKLKMLLTFVDKLPNGSEKGTYYALDLGGTNFRVLRVKLEGTRSS
TLEHDVYRQAIPQDLMTGSSEDLFDFIASSLKEFVEREGDISELSLDRRRELGFTFSFPV
KQMSVSSGTLLKWTKGFSIEDMVGREIAECLENAMTRKGLNMRVAALVNDSVGSLALGHY
HDTDTVAAVIIGTGTNACYLERTDAIIKSQGLLTTSGGMVVNMEWGNFWSSHLPRTLYDI
ELDADSPNPNDQGFEKLISGMYLGDVVRRVIVRMSQESDIFDPISSKLSMPFILRTPLIA
AMHEDDSPDLEEVRRILRDNLEIPDVPLKVRKLIVKVCDVVTRRAARLAAAGIVGILKKI
GRDGSGGIAGGRSRSDQKMRRTVVAMEGGLYTGYTMFRDYLHEALTEILGEDIAQHVIIK
VTEDGSAMGAALLAASHSSYPVDSVQLL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggtggcggtgggattggcagttggggtggcggtagcggcgtgtgcggtggcg
acggtggtggtcggtcggagaataaggagcagacggaagtggagaagagtggttggggtt
ttgaaggaactcgagcagagctgtgaaaccacagtggggaggttgaggcaggtcgtggac
gctatggctgtggagatgcacgcaggtttggcttctgatggtggctccaagctcaaaatg
ttactcacttttgtggataaactccccaatgggagtgagaaaggaacttactatgcgcta
gatcttgggggtactaattttagggtcttacgggttaagctagaaggcacgaggtcctct
accttggaacatgatgtatatcgacaagcgattcctcaagatttgatgactggctcaagc
gaggatctatttgattttattgcttcatcgttaaaggagttcgttgaaagagaaggtgat
atttctgagctttcattggacagaagaagggagcttggattcacattctcttttcccgtg
aaacaaatgtccgtgtcatcaggcactttattaaaatggacaaaagggttttccattgaa
gacatggttggaagagagattgcagaatgcttagagaatgcaatgaccaggaaaggccta
aatatgagggttgcagcacttgtcaatgactctgtgggatcattagcacttggacattat
catgacacagacactgttgctgcagtgataattggaacgggtactaatgcctgttatttg
gaaaggacagatgctataattaagtctcaagggcttcttacaacatctggaggcatggtt
gtcaacatggaatggggaaatttttggtcatctcatttaccaaggactctgtatgatatt
gaattagatgctgatagccccaatccgaatgatcagggttttgagaaattgatatcagga
atgtacctgggtgatgttgtgaggagagtgattgtcagaatgtcacaggagtcagatatt
tttgaccctatttcttccaagttatcaatgccttttattttgaggacaccattgattgct
gcaatgcatgaagatgactctcctgacttggaagaagtacgacgtatcttaagagataac
ctggagattccggatgtccctctaaaggttcgaaagctcatagtcaaggtgtgtgatgtt
gtgacccgtagggctgctcgattggcagctgctggtattgtggggatcttgaagaagatt
ggtcgggatgggagtggtggaatcgcaggtggaagaagtagaagtgatcagaaaatgagg
aggacggttgtggcaatggaggggggtttgtatacaggttatacaatgtttagagactac
ttacatgaagcattgactgaaatattaggggaagatattgcccaacatgtcataatcaag
gtcactgaagatggatcagccatgggagcagctctcctggctgcttcacattcgtcttac
cctgtggatagcgtacagttgctataa

DBGET integrated database retrieval system