KEGG   Prunus mume (Japanese apricot): 103340810Help
Entry
103340810         CDS       T03196                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pmum00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103340810
   00051 Fructose and mannose metabolism
    103340810
   00052 Galactose metabolism
    103340810
   00500 Starch and sucrose metabolism
    103340810
   00520 Amino sugar and nucleotide sugar metabolism
    103340810
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103340810
Enzymes [BR:pmum01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103340810
Membrane trafficking [BR:pmum04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103340810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
LG8
AA seq 498 aa AA seqDB search
MGKVAVGAAVVCAAAVCAAAALVVRHRMKSSGRWARAMAILREFEDKCGTPIGKLRQVAD
AMTVEMHAGLASEGGSKLKMLISYVDNLPTGDEQGLFYALDLGGTNFRVIRVQLGGKEKR
VVKQEFDEVSIPPNLMTGTSEALFDFIAEALAKFVATEGEGFHPAPGRQRELGFTFSFPV
WQTSIASGTLIKWTKGFNIEDAVEQDVVGELTKSVEKIGLDMRVTALVNDTIGTLAGGRY
HNQDVIAAVILGTGTNAAYVERAHAIPKWHGLLPKSGEMVINMEWGNFRSSHLPLTEYDQ
ALDAESLNPGDQIFEKIISGMYLGDIVRRVLCKMAEEASFFGDVVPPKLKVPFILRTPDM
SAMHHDTSPDLRVVGSKLKDILEISNTSLKMRKVVVALCDIVATRGARLSAAGIMGVLKK
LGRDTVKEGEKQKSVVALDGGLYEHYTEFRTSMESTLKELLGDEVAEHISVEHSNDGSGI
GAALLAASHSQYLEVEES
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggtggcggtgggggcggcagtggtgtgcgcggcggcggtgtgtgctgcggcg
gcgctggttgtacgacaccgtatgaagagctcggggaggtgggcccgggctatggcgata
ctgagggagttcgaggataagtgtgggacccccatcgggaagctgagacaggtggctgac
gccatgactgtggaaatgcacgctggcctcgcatccgaaggcggcagcaagctcaagatg
ctcatcagctacgtcgataacctccccactggggatgagcaagggctgttttatgcattg
gaccttggtgggacaaacttccgcgtcatacgtgtacagcttggtgggaaagaaaaacgt
gttgttaaacaagaatttgacgaagtttcaattccaccaaatttgatgactgggacttca
gaagcattatttgattttattgctgaagcacttgcaaaatttgttgctacggaaggagaa
ggttttcatcctgctcctggtagacaaagggagctgggttttaccttttcatttcctgtg
tggcaaacatcaatcgcatcaggaacccttattaagtggacaaaaggcttcaatattgaa
gacgcggttgagcaagatgtggtgggagagctgaccaaatcagtggaaaaaattggcctt
gatatgcgtgttacagctttggtcaatgatacaattggtacattagcaggaggtagatac
cacaatcaggatgtcattgctgctgtgatattgggcactgggacaaatgctgcttatgta
gaacgggctcatgccattccaaaatggcatggtcttctacctaaatcaggagagatggtt
atcaacatggagtggggtaactttcgctcatcacaccttccactgacagaatacgatcaa
gcacttgatgctgagagtttaaatcctggagatcagatctttgagaagatcatttctggc
atgtatttaggggacattgtgcgcagagtattgtgcaagatggctgaagaagcttccttt
tttggtgatgttgtccccccaaaactgaaagttcccttcatactaaggactcctgacatg
tctgccatgcatcatgacacgtctccagatctaagagtggttgggagcaaactaaaggat
atcctggagatctccaacacctcgttgaaaatgagaaaggttgttgtggcgctatgcgac
atagttgccactcgtggggcccgcctctctgctgcagggatcatgggagtgctgaagaag
ttaggtagagacacagtaaaggagggagagaagcaaaagtcggttgtagcattggatggt
ggtttgtatgagcactacaccgaattccgaaccagcatggagagcactctcaaggagttg
ctgggtgatgaagttgctgagcacatttccgtcgagcactcaaacgatggctccggaatt
ggagctgccctcttggcagcctctcactcccagtaccttgaggtagaggagtcataa

DBGET integrated database retrieval system