KEGG   Paenibacillus mucilaginosus K02: B2K_23760Help
Entry
B2K_23760         CDS       T02041                                 

Definition
(GenBank) beta-lactamase
Organism
pmw  Paenibacillus mucilaginosus K02
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(5687574..5692973)
Genome map
AA seq 1799 aa AA seqDB search
MIEILPEVNSLVDLLRCRAERQSDATAFSFLTEDGKENVLTYGDLDRRARTLAVWLARRD
AGGKRALLLYPPGLDYIAAFFGCLYAGTAAVPAYPPRLNANLRRMQSIVSDCRADFALTD
APTLAQLQLKFPDSPLLTELQWGVTDSWSEEDPGSWSAPAVGAQGNRLAFLQYTSGSTSA
PKGVMLTHDNLLHNLGLIQRSFGLTPESRSVIWLPPYHDMGLIGGILQPLYTGFPVTLMS
PAHFVQSPLKWLETISRTGASVSGGPNFAYELCVRRIAREELQALDLSRWTCAFTGSEPI
QAETLKRFAEVFEPCGFRYESFYPCYGLAESTLFVTGAQRGTGPVVRSFDGKMLEENRVV
TADSDSADRRSLVSSGCTLESDPLVVIVDPLTGERCGEDRVGEVWVTGRSVAQGYWNREE
QTAETFGGRLAGGGGGPFLRTGDLGFLSSGELFVTGRWKDLIIIRGRNYYPQDIEFCVSE
SHPAVRSGNGAAFSVTLDGEERLVIVHELERAYRKSDPMPVFESIVGAVAERCGLQVHAI
ALIRPASIHKTSSGKIQRSACRQAYLEGTLEILAKYREDGEYAGAEAPGEKEEADGSRKE
RPGLPDRAELLKLPNEERRRELVHYLCTETARMVKGPSRCGPESTLQTLGFDSLKIVEWK
ARIEEVLEVDIPFDTLLDGPNLSDTAAVIDRLLLSSESQGEKKRLQAEQASQAEFPLSAG
QRALWFLQKLNPAGRAYIISRTLHIRSGLRPELFVRAIDALHQRHPLLRSRVVERDGEPV
LIPDKAVRDCITYTDTAGWPEVQLLERIREASELPVDLEQGPLFRVHLYGCGEGEAYLLI
TLHHIIGDFWSFAVFAKEFGEVYSALTEDRNWTPAEPGSYRTYVERQSEAPAGEAESGLA
FWQNRLQGAEPVQLQHALPAPAPDEPPGRKVGFTLSSALSRRLAALVRESGCSQYSTLLS
AFTCLLHRYTGQSDLTVGTPTSGRLNRHDAGTFGYFVNPVVIRTASVPRETVREMIGRVH
QEVTEALKHQTYPFPLLVERLQPHRGGRQPLFNVMFSMHVPVLEQDDGLVAAALGLPGAA
VSLGPLTAELSEPAVQEAQFDLTLTMGRVGEVLHGTLEYDPARFTEEGMRRLPAHLTVLL
EGMAQNPDERAARLPLLTREEEARQAREWNSTITPYPGTALQERFESWAEQVPERTAVVY
QEQTVTYGELNRTANRLAHRLQSLGVGPDTLVGVCLDRSPELAAGLLAVLKSGGAYVPLD
PSLPAQRLAYMTERAGLKALVTKRAWAEGFTERAGLTVICMDEEKPVTGLYPETNPQNDA
GAEHLMYVIYTSGSTGTPKGASVYRRGFENLMQWYTGEFGMSEEDRILLISSPSFDLTQK
NIFAPLVTGGQLVLLPSGPYDAREVSGLICRHGITLLNGTPSAFYPLLQETEAQGYAGLS
TLRHVFLGGEAIAADKLAAWTQSPSCRAQVVNTYGPTECTDVTVFSRLTDMKPLAGKPVP
IGRPVPNTRLYILNSELGMVPAGAPGELCIAGVQVGGGYLGDPGLTAEQFTANPYGDEAA
PVLYRTGDLARYLPDGTVEYLGRMDHQVKIRGYRIEPGEIEAALRECGGVSDAFVMVRED
RPGEHQLAAYIVGGGVTGKGQDAADFVQQWRMDLRRKLPDYMVPSAFVLLDRLPLSPNGK
VDRKALPVPEGGGIREQPYTPPRTRTESALAGVWAEVLGLEKVGIHDNFFELGGHSLLAT
QVISRIRTSLQADLPVHRLFDTPTIAELAAALEEESAPKPSKPRMTRLSRSEHRVQLGP
NT seq 5400 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaatcctgccggaagtaaactcccttgtggatttactgcgctgccgtgctgag
cggcagagtgatgcgacggctttttcctttctaaccgaggacggaaaagagaacgtactg
acctatggtgatcttgaccggagagcgaggactctcgcggtatggctggcccgcagggat
gcggggggcaagcgagccctgctcttgtatccgcccggattggattatattgcagctttc
ttcgggtgtctgtatgccggaaccgctgcggtgcctgcgtacccgccccgcctgaatgcc
aacctgaggagaatgcagtccattgtatcggactgccgggccgattttgctctcacggat
gcccccacacttgcgcagcttcagctcaaatttcccgattctccattacttaccgagctt
caatggggagtcaccgattcgtggtcggaggaagatcccgggagctggagtgcgcctgct
gtgggagcacagggcaaccgtcttgcctttttgcagtacacgtcgggttctacgtctgcc
cccaagggggtcatgctgacccatgataatctcctgcacaacctggggctgatccagcgc
tccttcggtcttacgccggagagccgcagcgtcatctggctgcctccttatcatgatatg
gggctgatcgggggaatactccagccgctgtataccggatttccggtgaccttgatgtct
ccggcccattttgtccagagtccgctgaagtggctcgagaccatctcccggacaggagca
tccgtaagcggggggcctaacttcgcatatgagctgtgtgtccgcaggattgctcgggag
gagcttcaagccttggatctcagccggtggacctgtgcattcacaggctccgaaccgatt
caggcggagaccctgaagcggtttgccgaggtgttcgaaccgtgcggattccgttacgaa
tcgttttacccctgttatggtcttgcggagagtacgctttttgtcaccggagcgcagcgg
gggacaggccccgtggtgcgcagctttgatgggaagatgctggaggagaaccgggtggtg
acggctgactcggactccgcggacagacgcagcctggtcagctccgggtgcacccttgag
agcgacccgctggtggttattgtggatcccttaaccggagagcgctgcggtgaggaccgg
gtgggcgaagtctgggtcaccggcagaagcgtcgcccaaggatattggaaccgggaggaa
cagacggcggagaccttcggcggccggctggccggtgggggtggaggcccattcctccgc
accggagatcttggattcctgtcttccggggagctctttgtaaccggaagatggaaggac
ctgatcattatccggggcaggaattactacccgcaggatatcgagttctgtgtatcggag
agtcatccggcggtccgctcagggaatggagcggccttctcggtcacgctggatggagaa
gaacggttggtgatcgtgcacgagctggagcgtgcctaccgcaagagcgaccccatgccg
gtattcgagtcgatcgtgggagcggtagcggagcggtgcggactgcaggttcatgccatt
gctttaatcaggccggcgtccatccataagacgtcgagcggtaaaatccagcgcagtgcc
tgccggcaggcctatctggaaggtacgctggagatcttggccaagtacagagaggacggg
gagtatgcgggagcggaggctcccggtgagaaggaagaggcggacggttcaaggaaagag
cggcccgggttaccggatcgtgccgagttgctgaagctgccgaatgaggagagaaggagg
gaattggtacattatttgtgcacggaaacggcacgtatggtcaaaggtccgtcgcgctgc
ggtccggagagcacacttcagacgcttggcttcgattcgctgaagatcgtcgaatggaag
gcgcggatcgaagaggtactggaggtggacattccgttcgatacgctgctggatggaccg
aacctgtcggacactgcggcggtgattgaccggctgctgctgtcttcggagtctcaagga
gagaagaagaggctgcaggcagaacaggcttcacaggcggagtttcctctgtctgcgggc
cagcgggctctctggttcctgcagaagctgaacccggcaggccgggcctacatcatctcc
cggacgcttcacatccgcagcgggctgcggccggagctcttcgtccgcgctattgatgcg
ctgcaccagcgtcatccgctgctgcgcagccgggttgtcgaaagggacggcgaaccggtg
ctgatcccggacaaggcggtcagggactgcatcacctacacagatacggcgggctggcct
gaggtgcagcttctcgaacgcatccgggaggcttccgagcttcccgttgacttggagcag
ggccccctgttccgcgtacacctgtacggctgcggtgaaggcgaagcgtaccttctgatc
acccttcatcacatcataggagatttctggtcctttgccgtgtttgccaaggagttcggg
gaagtgtattcagcgctgaccgaagacaggaactggacgccggccgagcctggaagctac
cgtacctatgtagagcggcagagtgaagcgccggcaggggaggcagagagcggcttggcg
ttctggcagaaccgtctgcagggcgcggaacccgtgcagctgcagcatgcgctgcctgca
cccgcaccggatgaaccgccaggacgcaaggtcgggttcaccctgtcgtccgccctctcc
agacggctggcagccttggtcagagaaagcggatgctcccagtacagcaccctcctcagc
gcattcacctgcctgcttcaccgttatacaggacaaagcgacttgacggtagggacgccg
acttcgggccggttgaaccgccatgatgcagggaccttcgggtatttcgtcaacccggtg
gtcatccgtacggcgtcggttccccgggaaacggtccgtgaaatgatcggacgggtgcac
caagaggtgacggaggcgctgaagcatcagacgtatccgttcccgctgcttgtggaacgg
ctccagcctcaccggggcggccggcagcctctgttcaacgtgatgttctctatgcatgtc
cctgtgctggagcaggacgacggtctcgtggctgcggcacttgggctcccgggggctgcg
gtcagcctgggacctctcacggcggaactcagcgaaccggccgttcaggaagcgcagttc
gatctgaccctgacgatgggccgggtgggagaagtgctgcacggcacgctggaatacgat
ccggcccgctttactgaagagggcatgcggcggctgcctgcccacctgaccgtgcttctg
gaaggcatggcacagaatccggacgaacgtgcggcaagacttccgctgctaacgcgtgaa
gaggaggctcggcaggcccgggaatggaattccacaattaccccgtacccaggaacggca
ctccaggagcggtttgaatcatgggccgaacaggtaccggaacggaccgccgtcgtttat
caagagcaaaccgtaacgtacggcgaactgaaccggacggccaaccggctggcccaccgg
ctgcagtcgctgggcgtcggacccgatacgctggtcggcgtgtgtctcgaccgcagtccc
gagctggctgcaggccttctggccgtgctgaagtccggcggagcttatgtaccgcttgac
ccgtcgcttccggcgcagcggcttgcttacatgacggagcgggcgggattgaaggcgctg
gtcacgaagcgggcatgggccgaaggcttcaccgaacgggccgggctcaccgtcatctgc
atggacgaggagaagccggtcaccggtctctaccccgaaacaaatccgcagaatgatgcg
ggagcggagcatctgatgtacgttatctatacgtcgggctcgacggggacccccaagggg
gcaagcgtataccgccggggatttgagaatctcatgcagtggtacaccggggagttcggc
atgagtgaagaggaccggattctgctgatctcttcaccgagctttgatcttacccagaaa
aatatattcgctccgctggtgaccggcggacagctggtgctgctgccaagcggcccgtac
gatgcgcgggaagtatccgggctgatctgccggcacgggatcaccctgctgaacgggaca
cccagcgccttctacccgctgctgcaggagacggaggcgcaggggtatgcggggttaagc
acgctccggcacgtattcctgggcggggaagcgatcgccgccgacaagctggcagcctgg
acgcagtccccctcctgccgggcccaggtggtcaatacctacggacccacggaatgcacg
gatgtgacggtgttcagccgtctgacggatatgaagccgcttgccggcaagccggttccg
atcggacgtccggtgccgaatacacgactctatattttgaacagcgagctgggtatggtg
cctgcgggagcgccgggtgagctgtgtattgcaggtgtgcaggtgggcgggggttacctg
ggcgatccgggattaacggcggaacaattcacagccaatccgtacggggatgaggcggca
ccggtgctgtaccggaccggtgacctcgcgaggtatctgccggacggcacggtcgaatac
ctgggccggatggatcatcaggtgaagatccggggataccggattgaaccgggggagatc
gaagcggctctgcgggagtgcggcggagtaagtgacgccttcgtcatggtaagggaggac
cgtcccggcgaacatcagcttgccgcctatattgtggggggcggcgtaacgggcaagggg
caggatgccgctgacttcgtgcagcagtggcgcatggatctgcggcggaagctgccggac
tatatggttccttcggctttcgtcctgctcgaccggcttccgctgtcgccgaatggcaag
gtggaccgcaaggcactgccggtaccggagggcggcggtatacgggaacagccgtatacg
cccccgcgcacccgcacggaatcggccttggcgggggtatgggcagaggtgctggggctg
gagaaggtcggcattcacgacaacttttttgagcttggcgggcattcgctcctggccacc
caggtgatctcccggatcaggacctccctgcaggcggatcttcccgtacaccggctgttc
gatacgccgacgattgccgaactggcggcggcgctggaggaagaatccgcgccgaagccg
tccaagccaaggatgacccggctctcgcgcagcgagcaccgggttcaattgggcccttga

DBGET integrated database retrieval system