KEGG   Paenibacillus mucilaginosus K02: B2K_36940Help
Entry
B2K_36940         CDS       T02041                                 

Definition
(GenBank) bacillolysin
  KO
K01400  
bacillolysin [EC:3.4.24.28]
Organism
pmw  Paenibacillus mucilaginosus K02
Brite
Enzymes [BR:pmw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     B2K_36940
Peptidases [BR:pmw01002]
 Metallo Peptidases
  Family M4: thermolysin family
   B2K_36940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(8642644..8644221)
Genome map
AA seq 525 aa AA seqDB search
MKRKLTSAVLIASLSTTVISAASAASPNAEVQYSKEYNTPEFISGRWQAPQGLGKAEKVW
NYLDSQKSLFAVNGDPKENFEILEEIADPEKGTYHVRLAQKYKGLKVFGAQQTVHLEDNG
GNASYLGQFVPDLDKKAKLKQKPQLSAQQAVEKAKQDAGEAVGPLTKFEIPPQAELQIYV
QGEDASLAYILELNFLEPKPGRWQYVIDAVSGKILAKWNKLDEVSAAGTGVNGDTKAFQS
TASSTGYTLVDGARKINTYTAGNRTSLPGSIVRDTDNYWTDGAAVDAHAHAATTYDYYKN
VHGRSSYDNAGAAIDSTVHYSYRYNNAFWNGYQMVYGDGDGVTFKALSGSLDVVAHELTH
AVTEYSAGLIYQNESGALNESISDIFGAMLDSGDWLLGEDVYTPGTSGDALRSLSNPAAY
GDPDHYSKRYTGTADNGGVHTNSGINNKAAYLLAQGGTHYGVSVQGIGREKTGKIYYRAL
TVYLTPSSNFRNMRQAAIQAATDLYGSTSAEAASVKAAYTAVGIN
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagaaagcttacttctgctgtactaattgcttcattatcgaccactgtaatttcc
gcagcctcggctgcctccccgaatgcagaggtccaatattcgaaagagtacaacactccc
gagttcatctccggccgctggcaggcacctcaaggcctcggcaaagctgagaaagtgtgg
aattatctggactctcaaaaatcgctgtttgccgtgaacggggatccgaaagagaatttt
gaaatcctcgaagaaattgccgatccggagaaaggtacatatcatgtaagattggcacaa
aaatataaagggttgaaagtcttcggtgcgcagcagacggttcacctggaggataatgga
ggcaatgcttcgtacctggggcagttcgtcccggatctcgacaagaaggcgaagctgaag
cagaagccgcagctctcggcccagcaggctgtagagaaagccaagcaggatgcgggcgaa
gcggtcggtccgctgaccaagttcgaaattccgccgcaggccgagctgcaaatctatgtg
cagggggaggacgcttcgctggcgtatatcctggagctgaacttcctggagccgaagccg
ggccgctggcagtatgtgatcgatgcggtcagcggcaagattctagcgaagtggaacaag
cttgacgaagtatcggctgcgggtacgggtgtcaacggggacacgaaggcgttccaatcc
acagcgtcatcgaccgggtatacgctggtggacggtgcgcgcaagatcaacacgtatacg
gcgggcaaccgtacgagccttccgggttcgatcgtgcgcgacacggacaactactggacg
gacggtgcagccgttgatgcccatgctcatgccgcaaccacttacgattattacaagaat
gtgcacggccgcagctcttacgacaatgcaggagccgccatcgattcgacggttcattac
tcctacaggtataataatgctttttggaacggctaccagatggtatacggtgacggcgac
ggggttactttcaaggcgctctccggcagcctggatgtagtggctcatgagctcacccac
gctgtgaccgaatactcggcaggtctgatctatcagaatgagtcgggggcactgaatgag
tcgatctccgatatcttcggggccatgctcgacagcggagactggctgctcggcgaggat
gtctatacaccgggtacttccggtgacgcgctacggtcgctctccaacccggccgcatac
ggagatcccgatcattacagcaagcgttacaccggtacagcggacaacggcggagtgcac
accaacagcggcatcaacaacaaagccgcttacctgctggcccagggcggaacgcattac
ggcgtaagcgtgcagggcatcggacgggagaagaccggcaagatctactatcgtgccctt
accgtatacctgacgccttcttccaacttccggaatatgagacaagcggccattcaagcc
gcaaccgatctgtatggttccacctctgcagaggcggcatcggtcaaagcggcatataca
gccgtgggaatcaattaa

DBGET integrated database retrieval system