KEGG   Pseudomonas mendocina ymp: Pmen_3217Help
Entry
Pmen_3217         CDS       T00510                                 

Definition
(GenBank) ATP-dependent DNA ligase LigD phosphoesterase module / ATP-dependent DNA ligase LigD polymerase module
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pmy00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Pmen_3217
Enzymes [BR:pmy01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Pmen_3217
DNA repair and recombination proteins [BR:pmy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Pmen_3217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
3556803..3559316
Genome map
AA seq 837 aa AA seqDB search
MAKAQSEYSRKRNFERTSEPAERTGKRRSKAGALRFVVQKHDARRLHYDFRLELDGTLKS
WAVPKGPSLDPRDKRLAVHVEDHPLEYASFEGSIAEGNYGAGDVIVWDQGIWQPQGDPAA
AYAAGKLKFSLVGEKLSGDWTLVRTRLRGSGDKEQWLLIKERDDIARPSDEYDIVEAQPQ
SVISGALVGGPSAKAKGKTPSKAKAPKPAAAFPESLAPQLATLSDRPPEGDWLYEVKFDG
YRILARIRDGEVRLFTRNGHDWTQRLPLQAKALAKLGLHDSWLDGEVVALNEQGLPDFQQ
LQNAFDIGRSHDLVYYLFDAPFINGEDLRQTPLEQRRAQLKLLLGNTRNGPLRFSAAFTA
HHRDIVESACAMSLEGVIGKRAGSLYVSRRSADWIKLKCRLRQEFVIVGHTQPQGSRSGF
GALLLAVNEDDGLRYAGRVGTGFGEAALKALHQRLQELAREDSPLAHKLTAAQARGVSWV
EPQLVGEVEFAEWTREGIVRQASFVALRSDKPAAQIVRERPGAPQSSPPRKPAAKAGGKP
VVAGVAISNAQRVIDPDSGTSKLQLAQFYESIADWLLPYLNNRPVSLLRAPEGIGGEQFF
QKHAERLAIPNIKHLDPELDPGHARLMEIDSVAALVGAAQMGCIELHTWGATSDRIETPD
LFVLDLDPDPALPWRSMLEATRLTLTVLDELGLQAFLKTSGGKGIHIIVPLARRAGWDEV
KAFAKAIAQFMTSQLPERFTATSGPKNRVGKIFIDYLRNSRGASTVAAYSVRARPGLPVS
VPISRDELDGLRSAQQWTVGNLQQRLDGLKQDPWQGYSNRQRLTRAMWDRLGAKPPS
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggcgcagagcgaatacagccgcaaacgcaatttcgaacgcaccagcgagccg
gccgagcgcaccggcaagcggcgcagcaaggccggcgcgctgcgcttcgtggtgcagaag
cacgacgccaggcgcctgcattacgacttccgcctggagctggatggcaccctgaagagc
tgggcggtgcccaagggtccgagcctggacccgcgcgacaagcgcctggccgtgcacgtc
gaggatcacccgctggagtacgccagcttcgagggcagcattgccgagggcaactacggc
gccggcgacgtcatcgtctgggaccagggcatctggcagccccagggcgatccggccgct
gcctatgcggcgggcaagctcaagttcagcctggtcggcgagaaactgtccggcgactgg
accctggtgcgtacccgcctgcgcggcagcggcgacaaggagcagtggctgctgatcaag
gagcgcgacgacatcgcccgccccagcgacgagtacgacatcgtcgaggcgcagccgcag
agcgtgatcagcggcgcgttggtgggagggccgagcgccaaggccaagggcaagacgccg
agcaaggccaaggcgccgaagccggctgccgcctttcccgagagcctggcgccacagctg
gcaaccctgtccgaccgcccacctgagggcgattggctgtacgaggtgaagttcgacggc
taccgcattctcgcccgcatccgcgacggcgaggtgcgcctgttcacccgcaacggccac
gactggacgcagcgtctgccgctgcaggccaaggccctggccaagctgggcctgcacgac
agctggctggacggcgaggtggtggcgctcaacgaacagggcctgcccgactttcagcaa
ctgcaaaacgccttcgatatcggccgcagccacgacctcgtctactacctgttcgatgca
ccgttcatcaacggcgaggacctgcgccagaccccgctggagcagcgacgggcacagctc
aagctgctgctgggcaacacgcgcaacggcccgctgcgcttctctgccgcattcaccgcg
caccaccgcgacatcgtggaaagcgcctgcgccatgtccctggagggggtgatcggcaag
cgcgccggcagcctctacgtgtcgcgccgcagtgccgactggatcaagctcaagtgccgc
ctgcgccaggagttcgtcatcgttggccatacccagccgcaaggcagccgcagcggtttc
ggggcactgctgctggcagtcaacgaggacgacggcctgcgctacgccggacgcgtcggt
acggggttcggcgaagcggcgctgaaggcgctgcatcagcgtctgcaagagctggcacgc
gaggattcgccgctggcgcacaagctgaccgcagcacaggcccgcggcgtcagctgggtc
gagccgcagttggtcggcgaagtggaattcgccgaatggacgcgcgagggcatcgtgcgc
caggccagcttcgtcgccctgcgcagcgacaagccggcggcgcagatcgtccgcgagcgg
cccggtgcgccgcaatcctcgccaccgcgcaagccggctgccaaggcaggcggcaagccg
gtggtcgccggcgtggcgatcagcaatgcgcagcgggtgatcgaccccgacagcggcacc
agcaaactgcagctggcgcagttctacgaaagcatcgccgactggctgctgccgtacctg
aacaatcgcccggtatcgctgctgcgcgcaccggagggcatcggcggcgagcagttcttc
cagaagcatgccgagcgcctggccattcccaacatcaagcacctcgaccccgagctcgac
cccggccatgcccggctgatggagatcgacagcgtcgccgcgctggtgggcgcggcgcag
atgggctgcatcgaactgcacacctggggcgccaccagcgaccgcatcgagacgccggat
ctgttcgtgctcgacctcgacccggaccccgcgctgccctggcgcagcatgctcgaggcc
acccgcctgaccctgacggtgctcgacgaactgggcctgcaggcctttctcaagaccagc
ggcggcaagggcatccatatcatcgtgccgctggcacgacgcgccggttgggacgaggtc
aaggccttcgccaaggccatcgcccagttcatgaccagccagttgccggagcgcttcacc
gccacctccgggccgaagaaccgggtcggcaagatcttcatcgactacctgcgcaacagc
cgcggcgccagcaccgtggccgcctattcggtccgtgcgcggccagggttgccggtgtcg
gtgcccatcagccgcgacgagctggatggcctgcgcagcgcccagcaatggacggtcggc
aatctgcagcagcgtctggatgggctgaagcaggatccctggcagggctacagcaaccgc
cagcgcctgacacgcgccatgtgggacaggctcggcgccaagcccccctcgtag

DBGET integrated database retrieval system