KEGG   Prevotella melaninogenica: HMPREF0659_A6470Help
Entry
HMPREF0659_A6470  CDS       T01286                                 

Gene name
pyk
Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
pmz  Prevotella melaninogenica
Pathway
pmz00010  Glycolysis / Gluconeogenesis
pmz00230  Purine metabolism
pmz00620  Pyruvate metabolism
pmz01100  Metabolic pathways
pmz01110  Biosynthesis of secondary metabolites
pmz01120  Microbial metabolism in diverse environments
pmz01130  Biosynthesis of antibiotics
pmz01200  Carbon metabolism
pmz01230  Biosynthesis of amino acids
Module
pmz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pmz_M00002  Glycolysis, core module involving three-carbon compounds
pmz_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
pmz_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pmz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0659_A6470 (pyk)
   00620 Pyruvate metabolism
    HMPREF0659_A6470 (pyk)
  Nucleotide metabolism
   00230 Purine metabolism
    HMPREF0659_A6470 (pyk)
Enzymes [BR:pmz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     HMPREF0659_A6470 (pyk)
Membrane trafficking [BR:pmz04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    HMPREF0659_A6470 (pyk)
Exosome [BR:pmz04147]
 Exosomal proteins
  Proteins found in most exosomes
   HMPREF0659_A6470 (pyk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ADK96956
UniProt: D9RUZ2
LinkDB All DBs
Position
II:65087..66550
Genome map
AA seq 487 aa AA seqDB search
MKQTKIVCSISDRRCDVDFLRKLFFSGMNVVRMNTAHASPEGIKEIIRNTRTVSQHVALL
IDTKGPEVRTTAVDEPIHYKVGDMVKIFGRPDVDSTKDIVNVSYPDFARDVKVGDHVLFD
DGALDMVIVESAGPMLVAQVQNEGDLGSRKSVNVPGEHIELPALTEKDKANILLAIEEDI
DFIAHSFVRSAADVLAVQKILDEHNSDIKIISKIENQEGVDNIDEIIDASYGIMIARGDL
GIEVPIEQIPGIQRSIINKCILKKKPVIVATQMLHTMINNPRPTRAEVTDIANAIYSHTD
ALMLSGETASGKYPVEAVQTMARIAEAAEQDAHKRGHVTVPMVNQNDQREFLSRSAIEAT
EQLGVKGIITDSETGQTARNLAAFRGPHPVLAICYKDKVQRWLNLSYGVIAVYQHRYKSN
EEMFTAALRMLRQKGYIELEDKIAYLSGTFGVGGGTTFLEINKVGDVFARKYRFHLPEEV
DMGEDGE
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagacaaagatagtatgttctattagcgaccgtcgctgtgatgttgacttccta
agaaagcttttcttctcaggtatgaatgtcgtacgtatgaatacggcacatgcaagtcct
gaaggtattaaggagattattcgcaatacacgtactgtgtctcagcatgtagctttgctg
attgataccaagggaccagaggtgagaaccactgcagtggatgagcctattcattacaag
gtgggcgatatggttaagatattcggtcgtcctgatgttgattcaacaaaggatattgtc
aatgtttcttaccctgactttgctcgtgatgtgaaggttggcgaccacgttctctttgat
gacggtgcattggatatggtaatcgttgagagtgcaggtccaatgttagtcgcacaggtg
cagaatgaaggtgatcttggctcacgaaagagtgtgaatgtacctggtgaacatattgaa
cttcctgccttaacagagaaggataaggctaatattttattggcaatagaggaggatatc
gactttatcgctcactctttcgttcgttcagcagctgatgttcttgctgttcagaagatt
cttgacgagcataactctgatattaagattatctcaaagattgagaatcaagagggtgta
gacaatatcgacgagattatcgatgcttcatacggtatcatgattgcacgtggtgacttg
ggtatcgaggtgcctatcgagcagattcctggtattcagcgtagcattatcaataagtgt
atcttgaagaagaagcctgttatcgtggctactcagatgttacacacgatgattaacaat
cctcgtcctacgcgtgctgaggttactgacattgcgaatgctatctatagccacaccgat
gcgttgatgttgagtggtgagacagcaagcggtaagtatcctgttgaggctgtacagaca
atggctcgtattgctgaagcagcggagcaggatgcacataagcgtggacatgtaactgtt
ccgatggtcaaccagaatgatcagcgtgagttcttgtcaagaagtgctatcgaggctact
gaacagttgggtgtaaagggtattatcaccgatagcgagacaggtcagacagcgcgtaat
cttgctgctttccgtggtccacacccagtgttggctatctgctacaaggataaggtacag
cgttggttgaaccttagctacggtgttattgcagtttatcagcatcgttataagtcaaat
gaggagatgtttacagcagccttgcgcatgcttcgtcagaagggttacattgagttagag
gataagatcgcttatctttctggtacgtttggcgtaggtggtggcactaccttccttgag
attaacaaggtgggtgatgtctttgcacgcaagtatcgcttccatctccctgaagaagtg
gacatgggtgaggacggggaataa

DBGET integrated database retrieval system