KEGG   Prevotella melaninogenica: HMPREF0659_A6470Help
Entry
HMPREF0659_A6470  CDS       T01286                                 

Gene name
pyk
Definition
pyruvate kinase (EC:2.7.1.40)
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
pmz  Prevotella melaninogenica
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Class
Metabolism; Overview; Carbon metabolism [PATH:pmz01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pmz01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pmz00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pmz00620]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pmz00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
LinkDB All DBs
Position
II:65087..66550
Genome map
AA seq 487 aa AA seqDB search
MKQTKIVCSISDRRCDVDFLRKLFFSGMNVVRMNTAHASPEGIKEIIRNTRTVSQHVALL
IDTKGPEVRTTAVDEPIHYKVGDMVKIFGRPDVDSTKDIVNVSYPDFARDVKVGDHVLFD
DGALDMVIVESAGPMLVAQVQNEGDLGSRKSVNVPGEHIELPALTEKDKANILLAIEEDI
DFIAHSFVRSAADVLAVQKILDEHNSDIKIISKIENQEGVDNIDEIIDASYGIMIARGDL
GIEVPIEQIPGIQRSIINKCILKKKPVIVATQMLHTMINNPRPTRAEVTDIANAIYSHTD
ALMLSGETASGKYPVEAVQTMARIAEAAEQDAHKRGHVTVPMVNQNDQREFLSRSAIEAT
EQLGVKGIITDSETGQTARNLAAFRGPHPVLAICYKDKVQRWLNLSYGVIAVYQHRYKSN
EEMFTAALRMLRQKGYIELEDKIAYLSGTFGVGGGTTFLEINKVGDVFARKYRFHLPEEV
DMGEDGE
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagacaaagatagtatgttctattagcgaccgtcgctgtgatgttgacttccta
agaaagcttttcttctcaggtatgaatgtcgtacgtatgaatacggcacatgcaagtcct
gaaggtattaaggagattattcgcaatacacgtactgtgtctcagcatgtagctttgctg
attgataccaagggaccagaggtgagaaccactgcagtggatgagcctattcattacaag
gtgggcgatatggttaagatattcggtcgtcctgatgttgattcaacaaaggatattgtc
aatgtttcttaccctgactttgctcgtgatgtgaaggttggcgaccacgttctctttgat
gacggtgcattggatatggtaatcgttgagagtgcaggtccaatgttagtcgcacaggtg
cagaatgaaggtgatcttggctcacgaaagagtgtgaatgtacctggtgaacatattgaa
cttcctgccttaacagagaaggataaggctaatattttattggcaatagaggaggatatc
gactttatcgctcactctttcgttcgttcagcagctgatgttcttgctgttcagaagatt
cttgacgagcataactctgatattaagattatctcaaagattgagaatcaagagggtgta
gacaatatcgacgagattatcgatgcttcatacggtatcatgattgcacgtggtgacttg
ggtatcgaggtgcctatcgagcagattcctggtattcagcgtagcattatcaataagtgt
atcttgaagaagaagcctgttatcgtggctactcagatgttacacacgatgattaacaat
cctcgtcctacgcgtgctgaggttactgacattgcgaatgctatctatagccacaccgat
gcgttgatgttgagtggtgagacagcaagcggtaagtatcctgttgaggctgtacagaca
atggctcgtattgctgaagcagcggagcaggatgcacataagcgtggacatgtaactgtt
ccgatggtcaaccagaatgatcagcgtgagttcttgtcaagaagtgctatcgaggctact
gaacagttgggtgtaaagggtattatcaccgatagcgagacaggtcagacagcgcgtaat
cttgctgctttccgtggtccacacccagtgttggctatctgctacaaggataaggtacag
cgttggttgaaccttagctacggtgttattgcagtttatcagcatcgttataagtcaaat
gaggagatgtttacagcagccttgcgcatgcttcgtcagaagggttacattgagttagag
gataagatcgcttatctttctggtacgtttggcgtaggtggtggcactaccttccttgag
attaacaaggtgggtgatgtctttgcacgcaagtatcgcttccatctccctgaagaagtg
gacatgggtgaggacggggaataa

DBGET integrated database retrieval system