KEGG   Polaromonas naphthalenivorans: Pnap_0329Help
Entry
Pnap_0329         CDS       T00459                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pna  Polaromonas naphthalenivorans
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Pnap_0329
Enzymes [BR:pna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Pnap_0329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
332614..334200
Genome map
AA seq 528 aa AA seqDB search
MAIDALPARTRRKNLIDRLAEPRHYDVAVIGGGATGLGVALDAAARGFSVVLVESHDFAK
GTSSRATKLLHGGVRYLAQGNISLIREALHERSTLLANAPHLAQPLPFVMPCYKFWESPV
YGLGLKMYDTLAGKDGLGDTEFLNRPETLAHLPTLQPQGLKGGVKYWDGQFDDARLALAL
ARTAARQGALLVNYCAATKLIHEGGKLVGLCALDRETGHTHELHASCVVNATGVWVDRLR
MQDGKAVECTTKPMVAPSQGVHIVVEREFLPTDHALLIPRTSDGRVLFAVPWLGKTILGT
TDTPRHTLAREPLPFREEVDFLLRESARYLSRAPGRADIKSLWVGLRPLVKPTDDAAGST
KTLSREHTVLVSKSGLVTVTGGKWTTYRAMAGDVLEKCFAAGLLPARTGMPTDHLKLVGA
QRSSVRISEAPGLHLYGSEAGAVQALRGADHELGGGLTEAMVRFAARHEYARTVEDVLAR
RSRLLFLDAALARTLAPAVAALLQQENGMDAKLQSFLALCDQYLSVPA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgatgccttgccggcccgcacacggcgcaagaacctgatagatcggctcgcc
gaaccgcgtcattacgatgtcgccgttatcggcggcggggcaaccggcctgggcgtggcg
ctggatgctgcggcaagagggttttccgtcgtgctggtcgaatcgcacgactttgccaaa
ggcacttcgtcgcgcgccaccaagctgctgcatggcggcgtccgctatctggcgcagggc
aatatttcgctgatccgcgaagccttgcatgaacgctcgacgctgctggccaacgcgccg
cacctggcgcagccgctgccttttgtcatgccttgctacaaattctgggaatcgcctgtt
tatggactagggctcaagatgtatgacaccctggccgggaaggatgggctgggcgatacc
gaattcctgaaccgccccgaaaccctggcgcacctgccaacgctccagccgcaaggcttg
aagggcggcgtcaagtactgggacggccagtttgacgacgcgcggctggccctggcgctg
gcccgaaccgctgcccggcagggtgcgctgctggtcaattactgcgccgccaccaagctg
atccatgagggcggcaagctggtcgggctgtgcgcgctggaccgggaaacgggccatacc
cacgaattgcatgccagctgcgtggtcaatgccacgggtgtctgggttgaccggctgcgg
atgcaggacggcaaggccgtggaatgcacgaccaaaccgatggtcgcccccagccagggc
gtgcatatcgtggtggagcgtgagtttttgcccaccgaccatgccctgctgattcccaga
acgtctgatggccgggtcttgttcgccgtgccctggctgggaaaaaccattcttggcacg
accgatacgccgcgccacaccttggcgcgcgaaccgctgccgttccgggaagaggtcgat
ttcctcctgcgcgagtcggcccgctacctgagccgcgcgccaggccgggccgacatcaag
agcctctgggtcggactgcggccgctggtcaagccgactgacgatgctgccggcagcacc
aagacgctgtcgcgcgaacacaccgtgctggtcagcaagagcggcctggtcacggtgacg
ggcggcaaatggacaacttaccgcgccatggcgggcgacgtgctggaaaaatgctttgcc
gccgggctgctgccggcgcgtaccggaatgccgacagaccatctcaagctggtgggtgcc
cagcgctccagcgtcaggatcagcgaggcgcctgggttgcacctgtatggaagcgaagcc
ggcgcggtgcaggccttgcggggcgccgatcatgaattgggcggtggcctgaccgaggcc
atggttcggtttgccgcccgccatgaatatgcgcgtaccgtggaggatgtgctggcccgg
cgctcgcggctgttgttcctggacgcggcactggcgcgcaccctggcgccggcagtggca
gccctgctccagcaggaaaacgggatggacgcaaaactgcagtcctttttggcgctgtgc
gatcagtatttgagcgtgccagcctga

DBGET integrated database retrieval system