KEGG   Parastagonospora nodorum: SNOG_03803Help
Entry
SNOG_03803        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
pno  Parastagonospora nodorum
Pathway
pno00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    SNOG_03803
Enzymes [BR:pno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     SNOG_03803
Chromosome [BR:pno03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     SNOG_03803
   HMT complexes
    COMPASS/SET1 complex
     SNOG_03803
    COMPASS/SET1 complex (yeast)
     SNOG_03803
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET_assoc SET RRM_1 DUF4196
Motif
Other DBs
NCBI-GeneID: 5971212
NCBI-ProteinID: XP_001794349
UniProt: Q0UWR1
LinkDB All DBs
Position
Unknown
AA seq 1168 aa AA seqDB search
MSRSGQAISLSALTPLTTSSPSPRSAKTSYDTMNGTSSSRAAPSSAPENVANTITPVNTP
PETRKSVFPADGVMAKRILYDPYSDAKLEKKVRHSKPAQYKTVLDKGDPSPPPDPRLALA
GYTSGSYILKPTAKSKLRIAPYIAKPYAFDNRISCGPGPATQVVVTGFDPLTPDSQLRGF
FSTYGDVESLRAEVHPDNGSPLGICLIKFRDTPQARGSVAIKASTSAKRAEREGSNQRLG
QQVIKVHTDREGRRCAKLVELVVQKSRKQEENIRAKAAAKAAKASALATPATFDLPANVP
KGPSGRGARPPIPVPREPLNKKAALSHLIEKDPIKPKLKRAPYLFIAHQYVPVLSTTIDH
LKRRLKNFRWDALRCDQTGYYVVFASTKHGEDEAVRCFRECHMKPLFTYVMNMECQQYGD
PDYERSPSPERVMADKKRKAIEDRMDQEESADLELEKTQRAEAMDPVVAALEQLKQELQE
KILGDIKTRIAAPTLLELMQPERHVEKRRRLNIAEPRKKEEDIRPPSLLVPGLDPFGAGT
PKSRAAGFSGRGRKALGPYDRNRPGKKPPRIVNAFADERRKASAPKPRVARGLHRQMIEM
FEGPEESDDESRSNLTRGTEEQESRPISRAPSTDVEEEEEESSRAHRAKRRRIEAGWGED
SDDEMMDDSHARSLLAHCIHKDPENMAEKELEQVLAILPRSSPIWKKADKALKGFRRLRK
IEQEADAIFGVETSPVDKLDPEVIVTQDDEPSKPIETTELPETLKSLKKKQAAAKPKKKT
KKQLEEEAKSAKAEVTEISLPEEDIAEVKEHALVPEVSVTEDTPEEDDTGSVMWGVSSTE
PRKTVEDDFSVVMDIDGWQHMLKDEEDLLHLKAALQSIEAAKIGDAQSWAWKQKSIKHLN
RPGGEEGVSRTETKIEGYYVPNPTGSARTEGVKKIRESEKSKYLPHRIRVQREREERQRQ
AKKAEHAVISVEGFKFTTSSQKASTANSRANRANNRRMVNDINISKNMTGAEGDALRFNQ
LKKRKKLVKFDRSAIHNWGLYAQENIVANDMIIEYVGEKVRQRVADLREVRYDQQGVGSS
YLFRIDEDTVIDATKMGGIARFINHSCTPNCTAKIIRVDNTKRIVIYALRDIGQDEELTY
DYKFEREMDATDRIPCLCGSVGCKGFLN
NT seq 3507 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcggtctggtcaggcgatatcgctttccgcattgacacctctgacgaccagctcg
cccagtccgcgctccgccaaaacttcgtatgacacgatgaacgggacatcctcctcacgc
gcggcgccatcgagtgcgccagaaaatgtcgccaacaccatcacacccgtgaacacaccg
cctgagacaaggaaatccgtatttccagcagacggcgtaatggcgaagcgcatactatac
gatccctactccgacgcaaaactcgagaaaaaggtcaggcacagcaagccggcacaatac
aaaacggtcttggataagggcgacccatctcctccaccagacccacggctggctcttgct
ggatataccagcggaagctacattttgaaacctaccgccaagtcgaagctacgaatagcg
ccttatatcgctaagccatatgcattcgataaccgcatttcctgcggtcccggacctgcc
actcaggtggtagtaactggattcgaccctctgacaccagactcgcaactgcgaggattt
ttctccacttacggcgacgtcgagagcctacgtgcggaggtccatcctgataacggtagc
cctcttggaatctgtttgattaagtttcgcgacactccgcaggctcggggtagcgttgcg
atcaaagcatctacgtcggcgaagcgggcagaaagagaaggttcgaaccagcgcttggga
caacaggtcatcaaggttcacaccgatcgcgagggccgaagatgcgctaagctcgtagaa
ttggtagtgcaaaagagtcgcaaacaggaagaaaatatacgggcaaaagccgctgcaaaa
gcggcgaaggcttcagctcttgcaacaccagcgacgtttgatttgccggcaaatgtgccc
aagggaccttcggggcggggcgcacggccacctatacctgttccacgagaaccgctgaac
aagaaggctgcgctatcacacctcatcgaaaaggatccgatcaaacctaagctcaagcgc
gcaccttacctgttcattgcacaccaatacgtacccgtcctctccacaacaatcgaccat
ctcaagaggcgtctaaagaactttcggtgggatgctctacgttgcgaccagaccggctac
tatgtggtttttgcctctaccaagcatggcgaagacgaggctgtcaggtgtttccgcgaa
tgccatatgaagccactgtttacctatgtaatgaacatggaatgccagcagtatggtgac
ccggattacgagcgtagccccagtccggagcgtgttatggcggacaagaaacggaaagcc
attgaagaccgcatggaccaggaagagagtgctgatctggaactcgagaagacgcagaga
gcagaagctatggatccagtggtggcagccctagagcagctgaagcaggagctgcaagaa
aagattcttggggatatcaaaactcgcatcgctgctccgactttgctagagttgatgcaa
ccggagcgacatgttgagaagcgccgaaggttgaatatcgcggagccccgaaagaaggag
gaggacattcgaccgccatcgcttcttgttccaggattggatcccttcggtgccgggacg
cccaaatctcgtgctgcaggcttctctgggcgtggtcgaaaggctcttggtccatacgac
cggaaccgccctggcaagaaacctccacggattgtcaatgcttttgccgatgagcgacga
aaggcatctgcgcctaagccccgtgtggctcgtggcctgcatcgacagatgattgagatg
tttgagggccctgaagagtcagatgacgaaagccggagcaacctcacgcgtggcacagag
gagcaggagagccgtccgatcagtcgtgcaccgtcaacagacgtcgaagaggaggaggag
gaatcgtctcgagcacaccgtgctaagcggcgccgcattgaagctggatggggtgaagac
agcgacgacgagatgatggacgactcccacgcgaggagcctgcttgctcactgcatccac
aaggatccagagaacatggctgagaaagagctggaacaggtgcttgctattttgccacgt
tcttcgccaatttggaagaaggcagacaaagctctcaaaggcttcaggcggctgcgcaag
attgaacaagaggcggacgcaatctttggtgtggaaacaagcccggttgacaaacttgat
ccagaagtcattgtcacccaggacgatgaaccatccaaaccaattgagaccaccgagctt
ccagagacactcaagtcgctcaagaagaagcaggctgctgcgaagccgaagaagaagacg
aagaagcagctggaggaagaggccaagagcgccaaggctgaggtcacagaaatctctctt
ccagaggaggatattgctgaagtcaaggaacacgcgctggtacctgaggtgtctgtcacg
gaagatactcctgaagaggacgatactggttctgtaatgtggggcgtatcatcgaccgag
ccgcgcaagactgtggaagacgacttcagtgttgtaatggacattgatggttggcaacac
atgctgaaggatgaagaggatttgctacacctcaaagcagcactacagtcaatcgaggca
gccaagatcggagatgcgcaatcctgggcttggaagcagaagtctatcaagcacctcaac
cgcccaggcggcgaggagggcgtctcccgcacggaaaccaagatcgaaggatactatgtt
ccaaatcccacaggctcggctcgaacagagggtgtcaagaagatccgcgagtcggagaag
tccaaatacctgccccatcgtatccgtgtgcagagggagcgcgaagagcgtcaacgccag
gccaagaaggcggagcatgctgttatctccgttgaaggcttcaagttcacgaccagctca
cagaaggcgtcgactgccaactctcgtgcaaatcgtgctaacaatcgccgcatggtgaac
gacatcaacatttccaagaatatgaccggcgcagaaggtgatgccttgcgcttcaaccag
ttgaagaagcgaaagaagctggtcaagttcgatcgctccgccatccacaactggggtttg
tacgcacaggagaatattgtggccaacgatatgatcattgagtatgtcggtgagaaggtt
cgacaacgtgtggccgatttgcgagaagttcgatatgatcaacagggtgtgggatcgagt
tacctattccgcattgatgaggatactgtcatcgacgcaaccaagatgggtggcattgct
cgcttcatcaatcacagctgtacgccaaactgcacagccaagatcatccgtgtcgacaac
acaaagcgtatcgtcatctacgctttgcgtgacattgggcaagatgaggaactcacctac
gactacaaattcgagcgtgaaatggacgccacagaccgcattccttgtctctgcggatcc
gtcggctgcaagggcttcctcaactaa

DBGET integrated database retrieval system