KEGG   Parastagonospora nodorum: SNOG_07393Help
Entry
SNOG_07393        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
Organism
pno  Parastagonospora nodorum
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase p450
Motif
Other DBs
NCBI-GeneID: 5974622
NCBI-ProteinID: XP_001797729
UniProt: Q0ULH1
LinkDB All DBs
Position
Unknown
AA seq 1108 aa AA seqDB search
MASDAKAAWDSHVDTRTGITPPKPDEPSELAKLRASVGSKFGAFAALMGAAAAPVPQTGD
GSKLAEEDPTVLKKIEGIMRDMSHLRIENMQTLLEAQKHKMTGELMDDKTYFMEGLIRTA
AALPDGSKTRDTVTHSFLEQLWNDLEHPPQSYLGAKYQYRSADGSNNSLKHPQLGAAGTP
YARTVKPSMMQTPARPDPGVVFDSIMTRKHAELHPNRISSMLFYLASIIIHDCFRTSHED
YSVSMTSSYLDLSPLYGSNQAEQDQMRTMIDGKIKPDCFSESRLLFFPPGVGALLIMFNR
FHNYVVENLALVNEQNRFPKPAAEAPKSTGDEEKDEAAKAKYEKSKVKYDNDLFQTGRLI
TCGLYVNIILIDYVRTILDLNRTDSNWQLNPRAEMENVELGVGNQVSAEFNLVYRWHSTV
SDRDEKWTQEMWDGLFGEGRDPKTVGKWEFLQRLNDVYKTTDPDPSKRKFAGLARNQDGT
LPDQELVDMLVSSIEDCANSFGPNRVPSVFRAIEVLGIEQARSWNLGSLNEFRKHFDLEP
HKTFEDITSDKYVQEQLKHLYDHPDKVEIYPGIVVEDAKKPMAPGSGLCPGYTTSRAVLS
DAVALVRGDRFYTKDYNPSTLTNWGYRCVDSDTDIDNGCVFYKLFLRAFPNHFKQNSVYA
HYPLTIPSAMQEALKDLKKDKLYDFSKPTPASTLHVVKEYKLATQILLDQSTFKVAWGKA
MEFIMGPFGKEFSLAGDTPTNTASREMMSKALYVKDWEKDVRAFYTSKTKELLQEKSAHI
ADFNQVDIIRDVGNLAHVHFCAELFMLPLKTDERPHGIFTESELYLILSSVFALIFFDVD
PAGSFPLHVKARKATQVLGSVIEKNVEAIAHGGLLHAVTKAIWPEQGGLQNYGIHMIQRL
LQTGMPAPQLVWGHIFGTAGAMVANQGQLFAQTLEYYILGEGKAHWASIQALAHDESESA
FAKLMHYAMEGGRLNGETAVMRDVAQDSTTTTIRAGDRVFVDLRAASHDPNVFPNPDSVD
ITRPLDAYIHLGFGPHQCLGLPMVRVIMTAMLKEVAKLKNLRPAPGPQGKIHKVEKGVGE
EYPYHAYLTEMQDMYFPFPCSLKLVWDD
NT seq 3327 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgacgcaaaagctgcatgggatagccatgtcgacacaaggactggaattaca
ccaccaaagccagatgagccgtctgagcttgcgaaattgagagcctctgtgggaagcaag
ttcggagcatttgcggctctcatgggagctgcagcagcgccggtaccacagactggagat
ggctccaagcttgcagaagaggacccaactgtgctcaaaaagatagaaggtatcatgcgc
gacatgtcccacctccgaattgagaacatgcagactctcctggaagcccagaagcacaaa
atgaccggagagctgatggacgacaagacttacttcatggaaggactaatccgaactgct
gctgcgttaccggatggctcaaaaactagagacactgttacccatagtttcctggagcaa
ttgtggaatgatctagagcatccacctcaatcttaccttggagcgaagtaccagtatagg
tcggctgatggctcgaacaacagcttgaaacatccccagctcggtgcggcaggaacacca
tatgcgcgcaccgtcaagccctcgatgatgcagactcctgcgcgaccagatcctggcgtt
gtgttcgatagcatcatgacgagaaagcatgccgagctgcacccaaacagaatctcaagt
atgcttttctatctggcctccatcatcatacacgactgcttcaggaccagccatgaagac
tactccgtctcgatgacatcgtcatatctggatctttcgcctctgtatggcagcaatcaa
gcagagcaggaccagatgagaacgatgatagacggaaagatcaagccagattgtttctcc
gaatctcgtctgctgttcttcccacctggagtcggcgcgctgctgatcatgttcaaccgt
ttccacaactatgtagtggagaacctcgcacttgtcaatgagcagaaccgcttcccgaag
cctgctgcagaggcgccaaagtctactggtgatgaggaaaaggatgaggcagccaaggcc
aagtacgaaaagtccaaggtaaagtacgacaacgatttgttccagactggacgtctcatc
acgtgcggtctctacgtcaacatcatcctcatcgactacgtccgcactattctggacctc
aaccgcacagacagcaactggcagctcaatcctcgtgctgagatggagaacgtcgagctc
ggtgtcggtaaccaggtttctgcagagttcaacctcgtctacaggtggcactcgacagta
tctgaccgtgacgaaaagtggactcaggagatgtgggacggcctctttggtgaaggccga
gatccaaagactgtcggaaagtgggagtttctccagcgtttgaacgatgtgtacaagaca
accgatccagacccgtcgaaacgaaagtttgccgggctggcacgcaatcaggatggcact
ttgccagatcaagaactcgtcgacatgctcgtatctagtattgaagactgtgccaactct
tttggaccgaacagggtgccgtcagtgttccgcgccatcgaggtccttggtatcgaacaa
gcgcgaagctggaatctgggctctttgaatgagttccgaaaacacttcgatcttgagcct
cacaagactttcgaagacattaccagtgataagtatgttcaagaacagctcaagcacctc
tacgaccatccggacaaggtcgaaatctaccccggtatcgtagtggaagatgcgaagaag
cccatggcacctggctctggtctttgccctggatacacgacatcgcgcgctgtactgtca
gatgccgttgctcttgtccgtggcgatcgcttttacaccaaggactacaaccccagcaca
ctcacgaactggggctatcgttgtgtggatagcgatactgacatcgacaatggctgcgtc
ttctacaagctcttcctccgagctttccccaaccatttcaaacagaacagcgtatatgcc
cactatccgctcaccattccatccgccatgcaagaagctctcaaggatttgaagaaggac
aagctatacgacttctcgaagccgacgccagcaagtactctgcatgtcgtcaaagaatac
aaactcgccacacagatcttgctagaccaatccaccttcaaggtagcctggggcaaagca
atggaattcataatgggcccattcggcaaagagttctcgctcgccggcgacaccccaacc
aacactgcgtcgcgcgagatgatgtccaaagctctatacgtaaaagactgggagaaagac
gtgcgagcattctacacctccaagaccaaagaactcctgcaagaaaaatccgcacacatt
gcagacttcaaccaagtcgacatcatccgcgatgtcggcaatctcgcccacgtccacttc
tgcgcggagctcttcatgctcccgctcaaaaccgacgagcgcccgcacggcatcttcacc
gagtcggagctctacctgatcctgtccagcgtgtttgcgctcatcttcttcgacgtcgac
cccgcgggctcgtttccgctgcacgtcaaggcgcgcaaggccacgcaagtcctcgggtcg
gtcatcgagaagaacgtcgaggccatcgcgcacggcggcctgctgcacgccgtcacaaag
gccatctggcccgagcaaggcgggctgcagaactacggcatccacatgatccagcggctc
ctgcagacgggcatgcccgcgccgcagctcgtctggggccatatcttcggcaccgcgggc
gccatggtcgcgaaccaggggcagttgtttgcgcagacgctcgagtactacatcctaggc
gaaggcaaggcgcactgggctagtatccaggcgctcgcgcacgacgagagcgagagcgcg
tttgcaaaactgatgcattacgccatggagggcgggcgcttgaatggcgaaacggccgtc
atgcgagacgtcgcgcaagactcgacgacgacgacgattagggctggcgacagggttttt
gtagacctccgtgctgcgtcgcatgatccgaatgtcttccccaacccggactccgtcgac
atcacacgcccgctcgacgcgtacattcatctgggcttcggcccgcaccagtgccttggg
ctgccgatggtgcgcgtcataatgactgcgatgctcaaggaggtcgcgaagttgaagaat
ctccggcccgcgccggggccgcaggggaagatacataaagtagagaagggcgtgggcgaa
gaatatccgtatcatgcatacttgacggagatgcaggatatgtactttccgttcccttgt
tcgctgaagcttgtttgggacgactaa

DBGET integrated database retrieval system