Parastagonospora nodorum: SNOG_12830 Help Entry SNOG_12830        CDS       T01161                                  Name (RefSeq) hypothetical protein   KO K02183   calmodulin Organism pno  Parastagonospora nodorum Pathway pno04070   Phosphatidylinositol signaling system Brite KEGG Orthology (KO) [BR:pno00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     SNOG_12830  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pno01009]     SNOG_12830   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pno04131]     SNOG_12830    03036 Chromosome and associated proteins [BR:pno03036]     SNOG_12830   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pno04147]     SNOG_12830 Protein phosphatases and associated proteins [BR:pno01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      SNOG_12830 Membrane trafficking [BR:pno04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     SNOG_12830 Chromosome and associated proteins [BR:pno03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      SNOG_12830 Exosome [BR:pno04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    SNOG_12830 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 AIF-1 EF-hand_4 EFhand_Ca_insen UPF0154 SPARC_Ca_bdg EF-hand_11 TerB DUF5580_M SurA_N_2 Dockerin_1 RNA_pol_Rpb4 Poly_export PA_Ig-like DUF6279 Motif Other DBs NCBI-GeneID:  5979961 NCBI-ProteinID:  XP_001803048 UniProt:  Q0U5Y4 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRD NNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQDGDGRIDYNEFVQLMMQK NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgcgctcgctcggccagaaccccagcgagtctgagctccaggacatgatcaacgaggtc gatgccgacaacaacggcaccattgacttcccagaattcctcacaatgatggcccgcaag atgaaggacaccgactcggaggaggagatccgtgaagccttcaaggtcttcgaccgcgac aacaacggcttcatctctgctgccgagctccgccacgtcatgacctccatcggcgagaag ttgaccgacgatgaggtcgacgagatgatccgggaggctgaccaggacggtgacggccgc attgattacaacgagttcgtccagcttatgatgcagaagtaa

DBGET integrated database retrieval system