KEGG   Parastagonospora nodorum: SNOG_14568Help
Entry
SNOG_14568        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pno  Parastagonospora nodorum
Pathway
pno00250  Alanine, aspartate and glutamate metabolism
pno00410  beta-Alanine metabolism
pno00430  Taurine and hypotaurine metabolism
pno00650  Butanoate metabolism
pno01100  Metabolic pathways
pno01110  Biosynthesis of secondary metabolites
Module
pno_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SNOG_14568
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SNOG_14568
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SNOG_14568
   00430 Taurine and hypotaurine metabolism
    SNOG_14568
Enzymes [BR:pno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SNOG_14568
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 5981675
NCBI-ProteinID: XP_001804750
UniProt: Q0U153
LinkDB All DBs
Position
Unknown
AA seq 454 aa AA seqDB search
MSGTNDTNGAAQAETPLNRADEVKDLLTSLQDLIVPFIAAADEDAKTKHTGHGLKVEGGG
PRTTLVEHHPPKKLESILQKELEIGNDAGGKEGLMTLVETILKYSVNTWDQGFLDKFASN
ATAIVVARNTLYPETKSNGNGNLNLKIFTSAHGHYSVEKAANLYGFGTSSVIPIPVDSQG
SIIPSEFEKLVLASKDKGETPFFLNATAGTTVHGSFDPFTELSTICRAHNIWLHIDGSWG
GPVIFSPSHARTRLAGAHLADSITINPHKMLGVPLTCSFLLGADMNAFHRALTLPAGYLF
HNEAGTQARDIYDLADLTPQCGRKADSLKFFLALQYYGASHFQRVVENGYANAEYLLAKL
KESGRFVTISPEPLPCLQVCFYYAKEGKLEEDAEGNSKATADIANRLISRGFMIDYAPGD
KGKFFRVVVNGGTRTSTLDGLVKALEETASDLGF
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaactaacgataccaacggtgccgcgcaggcagagacaccgctaaatcgcgca
gacgaagtcaaagacttgctcacttcactccaagatttgatcgtccccttcattgccgct
gcagatgaagacgccaaaacaaaacacactggccatggtctcaaggtcgaaggcggcggt
ccgagaaccacactagtcgagcaccatcctcctaaaaagcttgaaagtattttgcagaaa
gagttggagattggtaacgatgcgggtggcaaagagggcttgatgacgcttgtggaaacg
attctcaagtacagtgtgaacacttgggatcagggcttcttggacaagttcgcctccaac
gctaccgccatcgtcgtcgcccgcaacaccctgtaccccgaaaccaaatccaacggcaac
ggcaatctgaacctgaaaatcttcacatccgcgcacggccattacagcgtcgaaaaagcc
gcaaacctctacggcttcggcacatccagcgtaatccccatccctgtcgactcccaggga
agcatcatcccgtccgaattcgaaaaactcgtgctcgcatcaaaggacaaaggagaaacc
cccttcttcctcaacgccacagccggcaccacagtccacggctccttcgaccccttcacc
gaattatccaccatctgccgcgcgcacaacatctggctccacatcgacggcagctggggc
ggccccgtgatcttctcgccctcgcacgcacgcacgcgtctcgccggcgcccacctcgca
gatagcatcaccatcaacccgcacaagatgctcggcgtcccgctgacgtgcagcttcctg
ctcggcgcggacatgaacgctttccaccgcgcgcttacactgcccgcagggtatctgttc
cacaacgaggccggcacacaagcgcgggacatctacgacctggcggatttgacgccgcag
tgtgggcgcaaggcggatagtctcaagttcttcttggcgctgcagtactatggcgccagc
cacttccaaagagtggtggagaacgggtatgcgaatgcggagtatctgctggccaagttg
aaggagagtggcaggtttgtcacgattagtccggagccgttgccgtgcttgcaggtgtgc
ttttattatgcaaaggaggggaagttggaggaagatgcggaggggaatagcaaggcgacg
gcggatattgcaaacaggctgattagtcgcgggttcatgatcgactatgcgccaggtgat
aagggcaaattcttcagggttgtcgtgaacggagggactaggacgagtacgctagatgga
ttggtcaaggcgctcgaggagacggcgagcgatttgggattttag

DBGET integrated database retrieval system