KEGG   Paenibacillus naphthalenovorans: IJ22_10360Help
Entry
IJ22_10360        CDS       T04167                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  
alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
pnp  Paenibacillus naphthalenovorans
Pathway
Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:pnp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    IJ22_10360
Enzymes [BR:pnp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     IJ22_10360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1061424..1062866
Genome map
AA seq 480 aa AA seqDB search
MRYLNYINGQWKEPVSGDYKLNLSPHNQEVLGEFPSSSAEDVQEAAAAAKKAFSSWKKLS
FQQRASYLIKAAAILNEKVEEVGRDLSLEEGKTLAEGIGETRRAISILEYYAAEARQPIG
EVIPSVNAETFLYTTRVPVGPVGLITPWNFPIAIPMWKMAPALIYGNTVVIKPADITPKC
VYHIISALDEAGLPAGVVNCVFGRGSVIGTALVENPHIKAISFTGSNQVGHQIQNQAVAS
GKKVQLEMGGKNPLVVLADADLEKAVDIAISGAFRSTGQKCTATSRVIVEEGIYEVFRDR
LVERTKQLKVGNPLDADTFIGPAVSQSQLDGVLELIEAGKAEATLLCGGERPTDPSLANG
FYVLPTVFENVSRDARIAREEIFGPVIALFKAKNYDEAIELANDTEFGLSAAICTNNLTL
AERFVEDIEAGIVHVNSETAGAEPQVPFGGCKNSSTGSREQGKTAIEFYTQVKTVYKDRL
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatttaaactacattaacgggcaatggaaagaaccggtttcaggagattacaaa
ttgaacttgagtccgcataatcaggaggttttgggagaattcccgtcaagttcggcggaa
gatgtgcaggaggcggcggccgcggcaaagaaggcattttcttcatggaagaagctttca
tttcaacagcgggcatcctatttgatcaaagcagcagccattttgaacgaaaaagtcgag
gaagtaggccgtgacctctcgctggaagaaggaaaaacattggcagagggcattggcgag
acacggcgtgcgatcagtattctggaatattatgcggcggaagcccggcagccgatcggt
gaagtgatcccttccgtcaatgcggaaaccttcttgtatacgacacgtgttccggtaggg
cctgtcggattgataaccccttggaattttccgattgcgattccgatgtggaagatggcg
ccggccctcatttacgggaataccgtggtgattaaaccggcggacattactccgaaatgc
gtttaccatatcatcagtgcacttgatgaagcgggactgcccgcaggcgtcgtcaattgc
gtatttggcagaggatccgtcattggtacggctttggttgagaatccgcatatcaaagcg
atttcgtttacaggctccaaccaagtcggccatcagattcagaatcaagccgtagcttcg
ggcaagaaggtccaattggagatggggggcaaaaatccgcttgtggtgctggccgatgcc
gacttggagaaagcggtggacatcgcgattagcggggcatttagatccaccggacaaaaa
tgtacggcaacaagccgcgttattgtggaggaaggcatatatgaagtcttccgcgaccgg
ctggtcgaacgtacgaagcagttgaaagtgggcaatccgttggatgcggacaccttcatc
ggccctgccgtatcccaatcgcagcttgacggcgtattggagctgatcgaagcggggaag
gcggaagcgacattgctctgcggaggcgaacggccaacggacccgtcgcttgcaaacgga
ttttatgtgctgccgaccgtattcgaaaatgtatcgagagatgcgcgaattgcgcgcgaa
gaaatattcggtccagtgatcgcgctgtttaaggcgaaaaattacgatgaagcgatcgag
ctcgccaacgatacggaatttggcttgagtgcggcgatctgcaccaacaacctgacgctg
gcggagcgatttgtcgaagacatcgaagcggggattgtgcatgtcaattcggaaacggcg
ggcgcggagccgcaggttccgttcggcggctgcaagaattcaagcacaggttcgcgggaa
cagggcaagacggcgattgaattctatacgcaggtgaagaccgtttataaggaccggttg
taa

DBGET integrated database retrieval system