KEGG   Paenibacillus naphthalenovorans: IJ22_43760Help
Entry
IJ22_43760        CDS       T04167                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
pnp  Paenibacillus naphthalenovorans
Pathway
pnp00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:pnp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    IJ22_43760
Enzymes [BR:pnp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     IJ22_43760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC OmdA
Motif
Other DBs
NCBI-ProteinID: ALS24662
UniProt: A0A0U2VVD1
LinkDB All DBs
Position
4363586..4365052
Genome map
AA seq 488 aa AA seqDB search
MTVQTEAKTYLNYIDGEWVAASTGKTDASINPANKHEIVGYIQKSGKEDLDRAVAAAKKA
FAQWRKLSGPARGEYLYKMANALERRLDEVAETMTREMGKTFPEAKGETARGIAILRYYA
GEGMRKNGDVIPSTDAEALMFTTRVPLGVVGVITPWNFPVAIPIWKMAPALVYGNTVVLK
PAQETAVTAAKVIECMAEAGLPAGVLNLVTGNGSVIGQGIIDHPDINGITFTGSDNVGKL
VGQGALARGAKYQLEMGGKNPVIVAADADLDLAVDATVSGGLRSTGQKCTATSRVIVQSA
VYEEFKQKLLAKVKEIKVGHGLQSDTWMGPCASQSQLDTVLSYIQKGKEEGATLLYGGSR
PEGEGLEHGFYVQPTVFENVKTNMTIAQEEIFGPVLALIKVDTIEEAIEIANDVKFGLSA
SIFTRDIANMLNFIKDIDAGLVRINAESAGVELQAPFGGMKQSSSHSREQGQAAIEFFTS
IKTVFVKP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtacaaacagaagccaaaacctatttgaactatatcgatggagagtgggttgcc
gcctccacgggcaagacggacgcgagcattaaccccgcgaacaagcatgaaattgtcggc
tacattcaaaaatccggcaaagaagacctggatcgtgccgtagctgctgcgaaaaaggcc
ttcgcgcagtggagaaagctgtccggcccggcgcgcggagagtacctgtataagatggcg
aatgctttggaaagacgcctcgatgaagtagcggaaaccatgacaagggaaatgggcaag
acgttcccggaagccaagggcgaaaccgcccgcggtatagcgattttgcgttattatgcc
ggtgagggcatgcgtaagaacggtgacgttatcccgtctacggatgcggaagctttgatg
ttcactacacgcgttccgcttggagttgtaggcgtcatcacgccttggaacttccctgtg
gccatcccgatttggaaaatggcgccggcgctcgtatatggaaataccgtagtgctcaag
ccggcccaggaaacggctgtcactgcggcgaaagtgatcgagtgcatggcggaagcagga
ctgcccgcaggtgtcttgaatctggttacaggcaacggttccgttatcggtcagggcatt
atcgatcaccccgatattaacggcattaccttcaccggttccgacaacgtgggtaaattg
gtcggacagggtgcgcttgcacgcggtgccaaatatcagctggagatgggcggtaaaaac
ccggtcatcgtggcggcggatgcggatttggatcttgcggtggatgcgaccgtcagcgga
ggtcttcgctctaccggtcaaaaatgtacggccaccagccgtgttatcgttcaaagcgcc
gtatatgaggaattcaaacaaaagcttctggccaaagtgaaggaaatcaaagtcggtcac
gggctgcaaagcgatacatggatgggcccttgcgccagccaaagccaattggataccgtt
ctttcttatattcaaaaaggaaaggaagaaggggccactcttctttacggcggcagccga
cctgaaggagaaggcttggagcatggcttctatgtacagccaacggtatttgagaacgtc
aagactaacatgaccatcgcgcaggaagaaattttcggacctgtgcttgctttgatcaag
gtagataccattgaggaagcgatagagatcgccaatgacgtgaagttcggtctcagcgcg
tccatctttacccgcgatatcgcgaacatgctcaatttcatcaaggatatcgatgcgggc
ctcgtccgtatcaatgcggaaagcgcgggcgtagaactgcaggctccgttcggcggaatg
aaacaatcgagctcccattcccgtgaacagggtcaagcggcaatcgaatttttcacttcc
atcaaaacggtatttgttaaaccataa

DBGET integrated database retrieval system