KEGG   Pandoraea norimbergensis: AT302_00525Help
Entry
AT302_00525       CDS       T04226                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pnr  Pandoraea norimbergensis
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pnr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AT302_00525
  Energy metabolism
   00680 Methane metabolism
    AT302_00525
Enzymes [BR:pnr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AT302_00525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4473014..4475986
Genome map
AA seq 990 aa AA seqDB search
MKSSATADTPQEGLAPSVGNTSPAEAASAATSTTGEAAAASPPGKERARRSREDKDAPLR
EDIRFLGRLLGDVLREQQGSDAFDLVETIRQNAVRFHREDDRSAAQALDTLLNGLSNEQA
IQVVRAFSYFSHLANIAEDRHHNRRRRVHALAGSKAQPGSLAAALQSLKDAGLADPATLQ
AFFASALIVPVLTAHPTEVQRKSILDAEREIARLLAHRDDALTERESARNTEAMRAYVTT
LWQTRMLRSSRLTVADEIDNALSYYRSTFLTEIPGLYADVSAELSEAAPGVRPQALGRFL
QMGSWIGGDRDGNPNVTAQTLQLAITRQATEIFAHYLEQVHLLGAELSVSQLLAGASDAL
LTLAKRSPDDSPHRTDEPYRRALIGVYARLAATAHAWVGHVPHRGAVGEASPYLDAAEFV
SDLNTVVASLMSHHGGALISQRLGPLVRAAEVFGFHLASIDLRQSSDVHEAVIAELFAKA
GVEANYAQLSEDEKLALLLQELREPRPLFSPYLDYSQRTRDELAVFGAAREIRARFGARA
VRNYIISHTETVSDLVEVMLLQKETGLFQGALGTANVTDADGEPTTGIKVGAMVIPLFET
IADLRNAPVIMRALFDIPGMADVVTQQGGEQEVMLGYSDSNKDGGFLTSNWELYKAELAL
VHLFEEKGIRLRLFHGRGGTVGRGGGPTYQAILSQPPGTVKGQIRLTEQGEIIASKFANP
EIGRRNLETIVAATLEATLLPSRNQPPQLDAYEAVMQTLSDTAFSAYRHLVYETPGFTDY
FFSATPIAEIAELNIGSRPASRKFSDPKQRRIEDLRAIPWGFSWGQCRLLITGWYGFGSA
VAAYLDAAQDDTARNERLETLRQMVKHWPFFANLLSNMDMVLAKTDLGVASRYAELVPDE
ALRKHVFDRIVAEWESTSKALALITGHEERLADNPMLARSIKNRFPYLDPLNHLQVELLR
RHRAGESDERARRGIHLSINGIAAGLRNTG
NT seq 2973 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcagcgcaacggcagataccccgcaagagggtctcgccccgtcggtcggcaac
acgtcacccgcagaagcagcatcggcggccacatccactactggtgaggccgcagccgct
tcgccgccgggcaaggaacgcgcccgccgctctcgcgaggacaaagacgccccgctgcgc
gaggacatccgcttcctcggccgcctgctgggcgacgtgctgcgcgagcagcaaggcagc
gacgccttcgatctggtcgaaaccattcgccagaacgccgtgcgctttcaccgcgaagac
gaccgcagcgccgcccaggcgctcgatacgctgctcaatggcctgtcgaacgaacaggcc
attcaggtggtacgcgccttcagctacttctctcacctcgcgaacattgccgaagaccgc
catcacaaccgccgccgccgcgtgcacgcgcttgctggcagcaaggcacagccgggcagt
ctggccgccgcactgcaaagcctgaaagacgccggtctggccgatcccgctacgctgcaa
gcgttcttcgcgagcgcgctgatcgtaccggtgctgaccgctcacccgaccgaagtgcag
cgcaagagcattctcgacgccgagcgcgagatcgcccgcctgctcgcccatcgcgacgac
gccctcaccgaacgcgaatcggcccgcaataccgaagcgatgcgtgcctacgtgaccacc
ctctggcagacacgcatgctgcgtagttcgcgcctgacggtggcggatgagatcgacaac
gcgctgtcgtattaccgcagcacgttcctgaccgaaattccgggcctgtatgccgacgtg
agcgccgagttgtcggaagccgcgcccggcgttcgcccgcaggcgcttggccgtttcctg
caaatgggtagctggatcggcggcgatcgcgacggcaacccgaatgtgacggcgcagacg
ctgcaactggcgatcacgcgtcaggccaccgagatctttgcgcactatctggaacaggtg
cacttgctcggggcagagctgtcggtgtcgcaactgctggccggtgccagcgacgcgttg
ctcacgcttgcaaagcgctcgcccgacgattcgccgcaccgcaccgacgagccgtatcgc
cgcgcgctgatcggcgtctacgctcgtctggcagccaccgcgcacgcgtgggtcggtcac
gtgccgcatcgtggcgccgtgggcgaggccagcccgtatctcgacgccgccgagttcgtc
tcggacctgaatactgtcgtcgcatcgctcatgtcgcatcacggcggcgcgctgatttcg
cagcgcctcgggccgctggtgcgcgcggccgaagtgttcggcttccatctggccagcatc
gacctgcgccagagttcggacgtgcatgaagccgttatcgccgaactgttcgccaaggcg
ggcgtcgaggcgaattacgcgcaattgtcggaggacgaaaagctcgcgttgttgctgcaa
gagctacgcgaaccgcgtccgctgttctcgccttatctcgactattcgcaacgcacgcgc
gacgagttggccgtgttcggcgcagcgcgcgagatccgggcgcgcttcggcgcacgtgcg
gtacgcaactacatcatttcgcacacggaaacggtgagcgatctggtcgaagtcatgctg
ctgcaaaaagagaccgggctcttccaaggggcgctcggtactgccaacgtgaccgacgcg
gacggcgagcccacgaccggcatcaaggttggcgcaatggtcatcccgttgttcgagacg
attgccgacttgcgcaacgcgccggtcatcatgcgcgcgctgttcgacatccccggcatg
gccgacgtggtgacgcagcaaggcggtgagcaggaagtcatgctcggctactcggacagc
aacaaggacggcggctttctcacgtcgaactgggagttgtacaaggccgaactggcgctg
gtgcacctgttcgaagaaaaaggcatccggctgcggctcttccatggccgtggcggcacc
gtgggccgtggcggcggcccgacgtatcaggccatcctgtcgcaaccgccgggcacggtg
aaggggcagattcgcctcaccgagcagggcgagatcatcgcgagcaagtttgccaacccc
gaaatcgggcggcgcaatcttgagaccatcgtcgcggccacgctcgaagccacgctgctg
cccagccgcaaccagccgccgcagctcgacgcctatgaagccgtcatgcagacgctctcg
gataccgcgttcagcgcctatcgtcatctggtctacgagacgcccggcttcaccgattac
ttcttctcggccacgccgattgcggagatcgccgagctcaatatcggctcgcgccccgcg
tcgcgcaaattctcggacccgaagcaacgccgcatcgaagacctgcgggcgattccgtgg
ggcttttcatggggacaatgccgcctattgatcaccggctggtacggcttcggcagcgcg
gtcgccgcatatctcgacgccgcgcaagacgacacggcacgcaatgaacggctggagacg
ctgcgccagatggtcaagcactggccgttcttcgcgaacctgctgtcgaacatggacatg
gtgctcgccaagaccgatctgggcgtggcgtcgcgttatgccgagctggtgcccgacgag
gccctgcgcaagcacgtgttcgaccgtatcgtcgcggaatgggagagcacgtcgaaggcg
ctggccctgattaccgggcatgaagagcgtctggccgacaacccgatgctcgcccgctcg
atcaagaatcgcttcccgtacctcgatccgctcaatcacttgcaagtggaactgctacgc
agacaccgtgcgggtgaatcggacgaacgtgcacgacgcggcattcatctgtcgatcaac
ggcatcgccgccggcctgcgtaatacgggctga

DBGET integrated database retrieval system