KEGG   Pandoraea norimbergensis: AT302_20515Help
Entry
AT302_20515       CDS       T04226                                 

Definition
(GenBank) hypothetical protein
Organism
pnr  Pandoraea norimbergensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2829740..2857924
Genome map
AA seq 9394 aa AA seqDB search
MVERLQSLAIERPDDIALICVQTGGETSHSYAELDQRANALAQRLGGGARKGERAILLMD
SGLSYFTAFFGCLYAGVLAVPAFAPGRTRDAYAERLRVMLADAEARWVLVTPEHAQIARS
LLDLYGETAELIVIDDAVAPKPSERVAIDLASDDIAFLQYTSGSTSAPKGVMVTHGNLIA
NEVAIQERLGVTASDVFVSWLPLPHDMGMIGTMLQPVYTGIPLVLMSPNHFLEQPIRWLE
AISRHGGTISGGPDFSYRLLTERVRDAQMEGLDLSGWRVAFSGSEPVRHDTLCEFVERFS
AWGFDAAAVYPCYGLAEATLLVTGVTRAGGMSAFNVDGADGEPKHLVSCGDVARDHEVRI
VDPSSGQTLGDGETGEIRFHGPSVTAGYWRNPAASAATFVEDDGRRWLRTGDLGMTQDGQ
LYVTGRVKDMIIVRGQNVYPQDVEQAIEAELDIVRAGRVSAFPVEFNGREGIGLAAEVSR
RTQKLLTPAQIVDELDAVVAPRFGEALGVVVLLNPGGLPKTSSGKLQRSAAARGWRERTL
DAWAVYANGAFDDAYGASHNRGPAAEPQAGQGHADNVAAATVATRLAAIWADVLGGQIDP
AEAHFFRLGGNSIQAVQLAARVQAAFHVPFDVRDVFEQSKLRDAAQTIAQRQGAAGHIDA
AAAIPQISRHTESDAVAPLTHAQHRLWFLWNLDPSDTAYHVGGRLTFDASPDVPALQAAL
RAAIARHSALRTTFDTDATGEPVQRVADASVASQFELTHTPLENDNAINEAAQAWIDAPF
DLRGGPMMRATLFETPDHRAHLVVALHHIVCDAWSMQGFVDALADDYRTCLSGGSPSALP
ESDLKYTDFAVWQRALRDHESRKRELAYWCARLGDDPAPAILGDRTRIGNAPRRAATHPF
DLPPSVLTGLAAAVASNGVTPSMLILAALGLVLRRHTASDDVRVGMPVANRQHGGTASLM
GLFVNTVVMKLDVQASGTLSALIAQVRETALEAQQHQDLPFDVLLDTLAPHRSLGQTPLF
QVMYNHVQQDERSLARWPALSTTLHGLDASAAQFDLTLDVQAYADGRLTPKFRYDADTFD
ASTVARLAAHLCNALQALVQHADTTVSAVALIERDERDRLVQWSANAQVSPGLPLHRRIE
AHAARTPEAVALTFEDTAMTYGELNARANQLAHALIARGVGLEARVGIALERSPEMVVAI
LAVLKAGGAYVPLDPQYPSERLSFLMSDSGMTLLLTRDALRGELPVPEGVATLLLEDFAT
ETNRTREGVVSNPDVPVSPSNLAYIIYTSGSTGKPKGALVTHANVGRLLDATQADFAFGP
QDVWTLFHSYAFDFSVWEIFGALCYGGRLVVVPYLVSRAADDFLTLLRRERVTVLNQTPS
AFRQLLQVPALAEADDLALRFVVFGGEALEPQTLRPWFDRFGDTAPRMINMYGITETTVH
VTFRQINRNDLSVTRSPVGRAIGDLGLYVLDAQGELAPIGVPGELHVSGAGLARGYWHRA
ALTAQRFIPDGFSGDGGRLYRTGDLARWRADGELDYLGRIDHQVKIRGFRIELGEIEAQL
LAQPGVHGAVASVQEGPGGARLIAHVAGDAHVPVLRAALGAVLPDYMVPKAIVVMPVFPL
TANGKVDRRALPAPEFGRGIDAAPRAGTEATLAHVWQTVLGVPSVGRHDNFFAIGGDSLL
TLKVVNRATLAGLTLSPRHLFEHQSLADLAEALDSAAAATNETAPPALVPVERAAGLSLP
LSYAQQRLWFLWHLQPESSAYHIAGGLRLQGAFDDNAKQAVQAAFDTLVARHESLRVTFA
PGDSDGDEGELAVPVAARQIVHDTMSITVRHYDVSHADDPEADAAALADAFARETFDLSR
GPLLRVGIVTLGEQAHQLLVSMHHIISDGWSVDRMLDEFVACYRAHRDHVTATLPVLPVQ
YADYAVWQRRWLDAGERDRQLAWWRGVLGDQHPVLALPADRERAELADYTAARHSFVLPA
QLTRRLRACAQRHDSTLFVALLTAYMAMLHRHAGAHDIRVGVPVANRERPEISDVLGCFV
NTQVMQARVGHTQPLGTLLQAVRAHVAGAQAHQDLPFDVLVNALQPERNLRHTPIFQVVL
NHRQPDHRVFDALDGLTVSRMDIAGRNAQFELTLDTEEADDGSVCAAMTYAREIFDEATV
ALWADHFVTFCEALAADTSISVGDVALHYADGSVMPVATDALVGDRGESGREVAVAIRST
QTQSGRNAFEAPVSPAEQAVAAAWQAVLQIDRVDRHDNFFEIGGDSILSLQIVSALARQG
WKITARQLFEAQTVATLAALAQPLAEGSRSVVKAKSQVRAPVGQADDNVEATYPATPLQS
GLLFHSLMQSGRGVYVNQKRLTLRGSLDHERMRDAWTRVMARHAILRTHFSWAHGGDAMQ
VVSRHVALPYTRHDWSAGPQATYDARLHAWLADDLAQGFDLAVAPLLRVNLFARPDGLTD
LVWTDHHVLLDGWSAAQLLAEVLAIYRRETLPEAASTPQYGDYVHWLTTQPDHADYWQAR
MQALDEPATLVASLPSAQGGHDATSGPLLQVDDVLDSAMDQRLREAARQHRVTLNTMIQA
AWALLTSRYGHRSQAAFGVTVSGRENDLPGIDRTLGLFINSLPMWVDVPAAATISAWLQD
VQQRGTALRAVETTPLRQVQQWSGRAAEALFDTLVVFENYPIDATVRADDASLSLAAFAT
TEQTHYPLVLAVLPGDTLTLRWKAKASRIDARTLAQLQADLRAILDQLSSTLDAGSTHVG
TITLAGQTVPSSLTRHEFTPVMHRIAAQAKATPQRPAIHCEGVRWSYRELDAAANRIAVA
LVAAGVRADERVGLCVERSPWMTAALLGVLRAGGAFVPLDPSYPSDRLVFMMEDAGVRRV
LTDAATAQAMASVLDGHEVIVVDTLDPADSAVVCHDVHPDQLAYVIYTSGSTGRPKGVAI
PHGAFSQHIDDFLNTYAITQDDKQLQSSTINFDVALHEMLPALCKGGQIEMRGPQAWDLA
TTSRHLSEEGVTFSRIPTAYWQQWLRNPPPREALAALRQITVGGEGLPGDALRQWQDGPL
SGIQLDNLYGPTETTVACMYRRTCEDDTQHAIVSIGVPYPSRRVYVIDAHGNEAPVDALG
ELCIAGHTLARGYLGRASLSAEKFVPDPFAGNGARMYRTGDLCRRRADGRIDFLGRLDAQ
VKLRGLRIELGEIDAVLRQVPGVRDAVVALVGAGEGARLAGYVVGDVADVVLRRSLERKL
PGHMVPSVFVHLDALPVMPNGKTDRAALPLPQDMASRERQAPVGPVQTALRDIWRDVLGR
DDVGVTDNFFEIGGDSILSLRVIAQAALAGLKLTPRHLFDAPDIERLALLAEPLHARPAH
VESREPLPLTPIQATFFDRHPHGEAHWNQAVLLQSESLPDAAALRRALDALVQAHDALRL
RFVRTPSGWQQQVVAVDAHNLLETLDLRGEPDWRAAIEREGSRVHRSLDIGQGPLLRALL
MHAPDGAYLLITIHHLAVDGVSWRVLLDELERGYHAAHEGRAIELSDNTPWSVWVQASTA
HAASADVIDELPWWRNALSGASPLFGATSKGRPRQTRHALLGAQATRQLVAQTRSSFGLQ
VDEALLGVLARALGDTFGCPDAIVAVEGHGRESLGRESSADLDLSGTIGWFTTRYPVRLP
VSGALADQLIATKDGLRDVPNKGLHWGLLAWHARDDVRRAAAALPVAQVGFNYLGNLDRA
VATGSTFALSTLPCGEMAAPAPAPFALDLNARIQDGALSITWDFDPDIVGATQVERCIER
FDARLQAFIEATRDRARIFSRSDFPRAALNAEQWRRLALDATGVEDVYPATAVQQGLLYH
DLSLPGEGMYITQKRVTLIGDLNIAALRQAWERAVARHAALRTRFAWHHGGPILQIVQSQ
ATLPFTVHPVPAGSTDIGAYERGFTQWLASDLRAGFDVERAPLLRVNVFMRPDNAADLVW
TAHHAITDGWSSALLMAEVVGTYRAVRGGDERQASAAPAVPYSRYVDWIARQPSSRDWWV
EQAGEVADRGQLLAYASSVSPEASTDALTFEDVLPDALGIKLVEAAQRHQVTINTVMQGA
WALLIAQHSFRQDVTFGVTVSGRPASLPGAQEMLGLCINSLPLFVTVKPSQDVGVWLRSV
QAQNVSLREHEHTPLASVQQWLGLNGTAPFDSLIVFENYPVAAGLLDGDATLRVGQVQGW
ERTHYPVTLTVATRGTPTLGWRFDTSRCSGEDAAQWRRQYLCLLEAMANTPVVGSRVADC
LTPTVDTLGELGVVQATAFDNATVPARIARQASLTPDAEALVLDDRTLTFAGLDAAANGL
ARRLAGMGITPEARVGVAMTRSIDMVVALLAVMKAGGAYVPLDPAYPPARIAHMIEDSGV
SVVLSQAAVSLALADGVRRLDIDDAVLAVRHTLPPEVALHGDNLAYVIHTSGSTGVPKGV
AVSHGALTCHVDATIAYAKLSAADRVLQFSTVNFDGFVEQLFPSLCVGATVVLRGPDVWS
SDEFVARVRRHGITVAHLPTAYWHALTQDLADSTESLAPLREFHAGGEAMSAQALRRTRE
SAALAPVTLINTYGPTEATITATVFDADEIGADALPSLSAFVPIGRALPGRRLYVVSPDL
SRVPHGAPGELLIGGELLARGYLNRPGLSAERFVPDAFGGEGGRLYRTGDLVRWRDDGAL
DYLGRIDHQIKLRGYRIEPGEIEAALTAQAGVREAAVVVRTEGTRARLIAYIGRDTAQPV
DGAQLRDALATRLPEYMVPETVVVLDALPLTPGGKVDRVALPDPGSASATFEAPQGEAER
VLADLWQTVLSVPQVGRHDNFFALGGDSILSLQVVARARQAGLTVSPKQLFTAPTLAALA
AVATQAGTTGAVRAPTDDAPGHVPLLPIQHAFFATGMRAVHHWHQALLLTPAEPLDVEAL
RQALVSVVAHHAALRMRFVPDTAAAGGWRQSYTPFNRESAEGMLWTRVAANTHDVEAIGN
EAHVSIHLTDGPVLRAVLIAMPDASQRLLLTAHHLVVDGVSWRILLGDLRTAYDAWRAGR
APALAATGTSYRTWAESLVDGASRSEQRDELAYWSSLRGATHLPVVDTDAPSLAGDLTRV
ERRFNRDITQQLLQDAGVAYRTQTGELLLVAVARALQAWTDAPDYVIALEGHGREPWSDD
VDLSRTVGWHTSLYPFAVQAQGDLRDAILRTKSALRAVPQRGLGFGVMRWLGDDATREAL
AAVPVPAVVFNYLGRFDSALGQDWQPAGEALGQTVASDTPLTHDLSIDAKVVGGELNVAL
SFSARRLKPQGVEALAAAIDTELSAILAHCLDETAAGVTSGDFPLAALDDAMLATLPLAW
RDVDDLYPLAPMQAGLLFHAMVDGQGGAYLNQMRVDIDGLDPARFEAAWQTVCARHPMLR
TGFVTTGSKLLQWVARQAPVPFLHLDWREQNTAPSDATDTLDALALAQREQPFDLAVPPL
QRVALVRTGVAKYHLIWTCHHLLLDGWSTSRLIGEVMRHYHGEPGSAPTATFRDYVQWLA
GQGASTSGSAAVFWRDTLGVLDEPTRLAPRELPPAAARDDFATEVTELDAATVSQLNRFA
ARERVTVNTLAQGAWALMLHQATGHQHVAFGTTVAGRPASLPGADTIVGLFINTVPVVSQ
RPERDAAGDWLRDLQSRRAQAGDFEHTPLHDIQRAALVTGALFDTLFVFENFPVDGALAE
AAAHGLTLTGASTDESTHYPLAVTVVPGDQWRIRWSYRTQAFSRADVSALSSRFAQTLRA
LSGDGLLAAADALRMTSDAAQHVAALGAPQPLPIHDARCLHERIAAHALQSPNATALRDG
DTIVTYGELDAQANRLAHRLLARGIGPEARIGIGMTRSPQMIVAMLATLKAGAAYVPVDP
AYPAERLSYLMADSGMRCLLTRSVDRDLLPVPEGLAVIDVADEALPDDVASSNAPMVAVH
PRQLAYVIYTSGSTGKPKGTQLTHANVMRLLDQTQARFGFGERDVWTLFHSFAFDFSVWE
IFGALCYGGTLVIVPHAVSRAPAEFAALLRDEGVTVLNQTPSAFRQLLQIPSMYEPGLRL
RTIIFGGEALEVRALAPWFAHYGDHGPALVNMYGITETTVHVTARELTPQDVDAERSPVG
RPIGDLGLYVLDAWGELAPLNIPGELHVSGAGLARGYLGRAGLTAERFVPNPFAHDGGRL
YRTGDLASWTDTGELVYLGRIDQQVKIRGYRIELGEIEAQLLRVPGVTNAAVIATSGAAD
ARLLAYVCGADTLDPASVRVALSQLLPDYMVPASVSVLAALPLTANGKLDRAALPAPEAQ
HAAGPAPAGETQVALAAIWSDLLGVAKVGRDDNFFDLGGDSILVLKVAARAAQAGITLTA
RQCFEAPTLAALAAAADVALGLGLPVDEAAAPIVRLTDRTHLPLSHAQQRLWFLWQLQPQ
STAYHVGGALLMRGAFDAAAARNAFGWLVQRHEALRTTFVMSERGEATQVVHDALPCAFD
HRTGDEASARAFAATWMAAPFDLVNGPLLRVGVVSMADDAHVLVVGMHHIVSDGWSMDIL
LSEFVDAYRAALAGEAGVAPDWAPLPVQYADYAVWQRDWLDAGARDAQLTWWRDALDGAP
GQVQPVLDLPTDRARQSLGDYHAARVSVDLPATVASGVRTLARRFATTPYVVLLAAFHAL
LHRHTGQDDIRVGVPVANRERAEVAGVIGLFVNTQVLRAQLDSRVTAATLIGQIDERARQ
ARLHQDLPFDALVDALQPERSLSHTPLFQVMFNHERDDQRALAQLPGVRVEPFPLGIGMG
EAQFELSLTTSETPEGAIRADLDYVRELFDAETAEQLAAQYVRLLSGFAETPDRAIGDIA
LHDVQGLDALLAWGRNDEGPACASPVHETIARQAAATPDAIAVILDDTRLTYGELALRAN
RLAQHLRGVCTATGEVRVGIAMRRSLDLVVAVLAVFKAGAAYVPLDPDYPQARLADIVSD
SGLAAILAHANVLDRLPANVALPVLCVDTLALDQGDDGNVCAPDVRVHPAQLAYVIHTSG
STGKPKGVAISHGVLARHVDVSARFAGISAADRVLQFSTINFDPFVEQLLPSLCVGGTVV
LRGPAVWSAAEFREQVEQHGITVADLPTAYWQMITRELGDGEALAGLREVHAMGEAMPLE
TLRQWRASRAFGGVRLLNTYGPTEAAVTATLFDATAADVDALPALVPIGVPLGQRSLYVV
DADFQLVPAGAIGELLIGGDLLARGYLNRPDLTAERFVPDPFGGSGGRLYRTGDRVRWRA
GGQLEYLGRTDHQIKIRGFRIEPGEIEAALLAQPSVGQAVVLARDVDGATRLVGYVTLAS
DHTGSEPDAASLRLALGAVLPDYMVPSALMVLDALPQLPNGKLDRHALPVPTFAKQAFEA
PQTALEQSLADLWHEVLSEGRRDTASVVRVGRHDNFFALGGDSIQILKIVARAANRGIAL
SPRQMFESQTVAALATSVVSAQGQQTGSACHTTASPMLPLIDRSHLPASHAQRRMWILWH
LDLQSSAYHIADSVRVRGKLDIGALQATFDAIVARHESLRTTFSQDADGDVRQLVHPATP
VAIVRDTHAPAQARSWAAAFMAQPFDLTQGPLLRVGLVTLGTDDHLLVVAMHHIVSDGWS
VDVILDEFAIGYRAAISGESPEWRALPVQYADYASWQRTVLNDAEKERQLAYWREALNDG
AQTLALPTDRARQALGRYRAARLPIALPPALATQLGALARQYETTVFTVLLAAFQAVLHR
HTGQQAIRVGVPVANRDRAEVQGLIGLFINTQVLGVTIAPRMTLDALLRQTRERVSGAQQ
HRELPFDVLVEALQPERSLVHSPLFQVMFNFEQEDRRALSSLPGLTTERFDAVDQAAQFD
LTLNLRSTPDGVIDGSCQYARELFDEATVARFMTHYVAVLTALATSSGQTIGEITLADKA
EVERLRAWGQGESTATGEVRPMAVHVAIAAQAARTPTAIALVLDDDSLTYAELDARACRL
ARHLHAAGVTPDTCVGIAMTRSLDMVVAMLAILKAGAAYVPLDPDYPLTRLTYMIEDSGI
RVLVRDTAVIGKLPQLAQVPGVNTLNADSLDLQSGTGATTAPATPVLPAQLAYVIYTSGS
TGQPKGVGIAHAALAGHIDATIRYARLTPSDRVLQFSTVNFDGFVEQLFPPLCLGATVVM
RGPDLWTTDEFVARVARHGLTVAHLPTAYWHVLTQDLADSKTSLAPLREFHAGGEAMSAH
GWRRTQASAALAPVTLINTYGPTEATITATVYDATAVTDVTAATFPGTVPIGRPLPGRSV
QVVGPDMAAVPQGAVGELVIGGDLLARGYLGRPALTAERFVPDPERTDGGRCYRTGDLVR
WRADGQLDYLGRIDQQVKIRGLRIELGEVEAALLALAGVREAVASAVQATSGEGNRLVAW
VVAEAGASLEASVLRPALARTLPAYMVPEAIVVLDALPMTPGGKVDRRALVMPSGDASQS
VTMAAIPRGDTETALAALWQSLLDVPFVGRDDNFFALGGHSLSALQLVSRVKSALGRQLS
LRDVFAAPTLTALAQQLELAPRVAVDGPALVSVPREERMPLSPTQYRLWLADKLASPDDA
ASYTLATAMRVTGNFDVDTARAAMAALVARHEVLRTCYPDDDGVPYARIAPMGEADIEVV
DLDGESADAQEIAIADAMAAQSRHRFILASGPLARIRLLRLAQNDHVVLFAVHHIIADGW
AMSVLVGEFANAYAAIRDGVAPAFAPMPVQYVDYADWQRKAVDGASGEVLRNYWRDALQG
APAALRLDTDHPRPVATSTAGAGVPFVLPQSLNAPLQAFAQHHGTTPSTVLLASYQAFLH
RLTGMDDLVVGVDSAGRHDEALEPMLGFFVNVLPVRSRVDAREPSFGALTGRTHDAMLGA
IAHEALPFERIVEASGVGRASGRSPLVQTLFVMQNTPRGALAIDGLHIDPIKQASASSKF
DMALFLHETPLGFAGEWVFATDLFVHASIERFVATWLKLLETYLMEPDTPTPPTPPMTPP
LAQDAARTRDAARAAKLEKLGALGGGRKPARPVAGAALGNTGNGTTQDYQVRITPMQAGT
GFPALIEPQHADLDPFVWAARHREQIDIWLARHGGLLLRGFAIEGPRQFERFVEAIVPEL
YGDYGDLPKKEEGDRTYRSTPYPEKEMILFHNESSHLEQWPRKQWFYCELPSQVGGATPI
VDGREMLRRLPPDVVDRFARLGLCYVRTFIEGLDVPWRQFFHTDSREDVEARCRAVGTQV
RWFGDTLQTVSRGPGVLRHPVTGELAFFNQVQLHHPYFLAPDVRQHLMDIAGEDRLPRNV
LYGDGTPIDDETMALIGKAYEACAFRFDWQRGDVVMLDNLLVAHARDPYQEPRKIVVAMA
QMMSRDSVPATNVDSGAASTVNPPISMPLGDDHA
NT seq 28185 nt NT seq  +upstreamnt  +downstreamnt
atggtcgagcggctgcaatcgctcgcaatcgaacgccctgacgatatcgcgctgatttgc
gtgcagaccggcggcgagacgtcgcacagctacgccgaactcgatcagcgtgccaacgca
ctggcgcagcgtctgggcggcggggcacgcaagggcgagcgagcgattctgctgatggac
agtggcctgtcgtatttcacggcgttcttcggctgcctgtatgcaggcgtgctcgccgtg
cccgcgttcgcgcccggacgcactcgcgatgcctacgccgagcgcctgcgagtgatgctt
gccgacgccgaagcccgatgggtgctcgtgactcccgaacacgcgcaaatcgcccgttcc
ctgctcgatctgtatggcgaaacggcggagttgatcgtcatcgacgacgcggtcgcgccg
aaaccctcagagcgcgtcgccatcgatctggcgtcggacgacattgcgtttctccagtac
acgtctggctcgacgtcggcgcccaagggcgtgatggtcacgcacggcaacctgatcgcc
aacgaagtcgcgattcaggaacgccttggtgtcacggcatccgacgtcttcgtcagctgg
ctgccgctgccgcacgacatgggcatgatcggcacgatgctccagcccgtctacacgggg
attccgctcgtgctgatgtcgccgaatcactttctggaacagccgatccgttggctcgaa
gccatttcgcgccacggcggcacgatctcgggcgggcctgacttctcttaccggctgctg
accgagcgcgtccgcgatgcgcagatggaggggctggacctgtcgggatggcgggtggct
ttctcggggtcagaaccagtgcgtcacgacacgctgtgtgaattcgtcgagcggttcagc
gcctggggtttcgatgcggcggcagtgtatccctgctatggactggccgaggcgactctg
ctggtcacgggggtgacgcgtgcgggcggcatgtcggctttcaacgtcgacggcgcagat
ggcgagccaaaacatctggtgagctgcggcgacgttgcgcgcgatcacgaggtgagaatc
gtcgacccgtccagcggacagacgcttggcgacggtgagaccggcgaaatccgcttccac
gggccgagcgtaacggcaggctactggcgcaatccggctgcgagtgcagcaacgtttgtc
gaagacgacggacgtcgctggctgcgcacaggcgatctgggcatgacgcaagacgggcag
ttgtatgtgaccggccgcgtgaaggacatgatcattgtgcggggccagaacgtgtatccg
caggacgtcgagcaggcgatcgaggcggaactcgacatcgttcgcgcaggccgcgtctcg
gcatttcccgtcgaattcaacggacgtgaaggtatcgggctggcggccgaagtctcgcgc
cgcacgcagaagttgctcacaccggcgcagatcgtcgacgaactcgatgctgtggtcgcc
ccgcgtttcggcgaagccttgggcgtcgtggtcctgctcaatccgggcggtctgccgaag
acgtcgagcggcaagttgcaacgctctgcggcggcgcgcggctggcgcgagcgcacgctc
gacgcttgggcagtctatgcgaacggtgcgttcgacgacgcctatggcgcctcgcacaac
cgtggcccggcggctgaaccgcaagccgggcagggccacgctgacaatgtcgctgccgca
accgtcgcaacacgactcgccgcgatctgggcagacgtcctcggcgggcaaattgacccg
gccgaggcgcatttcttccgtctcgggggcaactcgattcaagccgtgcaactggctgca
cgtgtgcaggcagcgtttcacgtgccattcgatgtgcgcgacgtcttcgagcaatccaag
ctgcgcgatgcggcgcaaaccattgcgcagcgccaaggggcggcgggacacatcgacgcc
gcggctgccataccgcagatttcccggcacacggaaagcgacgcggtcgcaccgctcacc
cacgcacagcaccgtctctggtttctctggaacctcgatccgtcggatacggcttatcac
gtgggcggccggctgacgtttgatgccagccccgacgtgccagcattgcaggcggcgttg
cgagccgccatcgcgcggcactccgcgttgcgcacgaccttcgacacagacgcaacgggc
gaacctgtccaacgcgtcgccgatgccagtgttgcgtcgcaatttgaactgacgcatacg
ccactcgagaacgacaacgccatcaacgaagcggctcaggcatggatcgacgcgcctttc
gatctgcgcggtggcccgatgatgcgggccacgttgttcgagacaccggatcaccgggcg
catcttgtcgtagcgctgcaccacatcgtgtgcgacgcatggtcgatgcagggtttcgtc
gacgcactggcggacgactaccgcacctgcctgtccggcggctcaccttcggcgctaccc
gaaagtgatctgaagtacaccgatttcgctgtctggcagcgggcgttgcgcgaccacgaa
tcgcgcaagcgtgaactggcttactggtgcgcgcgactgggtgacgatcctgctccggcc
atccttggcgatcgcacgcgcatcggcaatgcgccacgacgcgccgcaacgcacccgttc
gaccttccgccatcggtgctcacggggctggctgcggcagtggcatcgaatggcgtgacc
ccgtcgatgctgatcctcgctgcgctgggtctcgtgctgcgccggcacacggccagcgat
gacgtgagagtcggcatgccggtcgcaaaccggcaacacggcggtaccgcctcgctcatg
ggcctgttcgtcaacacggtggtcatgaagctcgacgttcaggcgtcgggtaccttatcg
gcgctgatcgcgcaggtgcgcgagacggcgctggaagcgcagcagcatcaggacctgccg
ttcgacgtgctgctcgatacgctggcgccgcaccgcagtctcggccagacaccgctgttt
caggtgatgtacaaccacgtgcagcaggacgagcgctcgctcgcacgctggccggcgcta
agcaccacgctgcatggcctcgatgcgagcgccgcacaattcgacctcacgctggacgtg
caggcgtacgccgatggccgtctcacgccgaaattccgttacgacgcggatacgttcgac
gcatcgaccgtcgctcggctcgcggcccacttgtgcaacgccttgcaggcgctggtgcag
catgctgacacgaccgtcagtgccgttgccctgatcgaacgcgacgaacgggatcgactc
gtgcaatggagcgccaatgcacaggtatcgccggggttgccgttgcatcgacgtatcgaa
gcacacgcggcccgaacgccggaagccgtggcgctgacgttcgaagacaccgccatgacc
tacggcgagttgaacgctcgcgccaaccagcttgcccatgcgctgatcgcgcggggcgtt
gggctggaagcccgtgtcggtattgcgctggagcgctcgcccgagatggtggtcgccatt
ctggcggtgctcaaggccggtggcgcgtacgtgccgctggacccgcagtatccgtccgaa
cggctgagtttcctgatgtcggacagcggcatgacactgctgctgacccgcgacgccttg
cgcggcgagttgccggtgccggaaggcgtcgccaccttgttgctggaggatttcgcgacg
gagacgaaccgcacgcgggaaggcgttgtttccaatcccgatgtgccggtctcgccgtcg
aatctggcgtacatcatctacacctcaggttcgacgggcaaaccgaagggcgcgctggtc
acgcacgcgaacgtcgggcgtctgctcgatgcgacacaagcggacttcgccttcggcccg
caggacgtatggacgttgttccactcgtacgccttcgacttctccgtatgggaaatcttc
ggcgcgttgtgttacggcggccgtttggtcgtcgtgccgtacctcgtgagtcgcgcggcc
gacgactttctgacgttgctgcgccgcgaacgggtgaccgtactgaaccagacaccgtcc
gcgttccggcagttgctgcaagttccggcgctggcagaggctgacgatctggcgctgcga
ttcgtcgtcttcggcggtgaagcgctggagccgcagacgctgaggccgtggttcgaccgc
ttcggcgataccgcgccgcgcatgatcaacatgtacggcatcaccgagacgacggttcac
gtgacgttccgtcaaatcaaccgcaacgatctgagcgtgacacgcagcccggtggggcga
gccatcggtgatcttggactgtacgtactcgatgcgcagggggagttggcaccgatcggc
gtgcccggtgagctgcatgtgagcggcgcgggccttgcgcgcgggtactggcatcgcgca
gcgttgactgcacaacggttcattcccgatggcttttcgggcgatggcggacggctctat
cgcactggcgacctcgcgcgctggcgcgcagacggtgaactggactatctggggcgcatc
gaccatcaggtcaagattcggggcttccgcatcgagttgggcgagatcgaggcgcagctg
ctggcgcagcccggtgtgcacggcgcggttgcgagtgttcaagaggggccgggtggggcg
cgtctgattgcccacgtggcgggtgacgcacacgtaccggtgctacgcgccgcgctcggt
gccgtgctgcccgactacatggtcccgaaagccatcgtggtcatgccggtgtttccgttg
acggccaacggcaaggtggaccgtcgcgccttgccggcccctgaatttggccggggcatc
gacgccgcgccgcgtgcggggaccgaagccactctggcgcacgtctggcagaccgtgctg
ggcgtgccgtcggtcgggcgtcatgacaatttcttcgccatcggtggcgactcgctgctg
acactgaaagtcgtgaaccgggcaacgctcgccgggctaacgctctcaccgcgccatctg
ttcgaacatcagagtctggccgatctggcggaagccctcgatagcgcagcggctgcgact
aacgagaccgccccgcccgcgctggtcccggtggaaagagcggctggcctctcgctgccg
ctgtcgtacgcccagcagcggctgtggttcctgtggcatctgcaaccagaaagctcggcg
taccacatcgcgggcgggctgcggctgcaaggtgcgttcgatgacaacgccaaacaagcg
gtgcaagccgcgttcgatacgctcgtcgcacgccacgagtcgctgcgtgtcacgtttgca
ccgggagatagcgacggcgatgagggcgagttggccgtgccggtcgccgcacggcaaatc
gtgcacgacacgatgtcgattaccgtacggcattacgatgtcagccacgccgacgacccc
gaggccgacgctgcggcgctggccgatgcgttcgcacgcgagaccttcgatctctcgcga
ggcccgctgttgcgtgtcggcatcgtgacgctgggcgagcaagcgcaccagttgctggtc
tcgatgcatcacatcatctcggacggctggtccgtcgaccgcatgctcgacgagttcgtc
gcctgctatcgtgcccatcgggatcacgtgaccgcgacgctgcctgtgttgccggttcag
tacgccgactacgccgtgtggcaacgccgctggctcgatgccggtgaacgggatcgtcaa
ctggcgtggtggcgtggcgtattgggcgatcaacatccggtgctggcgctcccggcagat
cgcgaacgcgccgaactcgccgattacaccgctgctcggcattcgtttgtgcttccggcc
cagttgacccgccgcctgagggcctgcgcccaacgccacgacagcacgcttttcgtcgcc
ttgctcacggcctacatggccatgctgcatcggcatgccggtgcacacgacattcgcgtc
ggggtgcccgtcgcgaatcgcgaacggccggaaatcagcgacgtgctcggctgctttgtg
aacacgcaggtcatgcaagcgcgggttggccatacgcagccgctaggcacgttactgcaa
gccgtccgcgctcacgttgcgggtgcgcaagcgcatcaggacttgcctttcgatgtcctc
gtcaacgccttgcaaccggagcgaaaccttcggcacacgccgatctttcaagtggtgctg
aatcaccgtcagcccgaccatcgggtcttcgatgcgctcgatggcctcacggtgtcccgt
atggatatcgcgggccgcaatgcccaattcgaactgacgctcgatacggaagaggcggac
gacggctcggtgtgcgccgcgatgacctacgcgcgggagatcttcgacgaagcgaccgtg
gccttgtgggcggatcacttcgtgacgttctgtgaggcattggcagcggatacctccatc
tcggtaggggatgtggcgcttcactacgccgatggcagcgtcatgccggtggccaccgat
gcgcttgtgggagatcggggagaaagcggccgcgaagtcgctgtagccattcgatcgacg
caaacgcagtccgggcgaaacgcctttgaagcgcccgtctcgcccgctgagcaggccgtc
gcagcagcatggcaagccgtgctgcaaatcgaccgtgttgaccgccacgacaacttcttc
gagatcggtggcgactcgatcctgagcctgcaaatcgtctccgctctggcacgacagggc
tggaaaatcaccgcgcgccaactgttcgaagcccaaacggtggcgacactcgcggcgttg
gcgcagccactggccgagggttcgcggtccgttgttaaagcaaaatctcaagtgcgggcg
ccggttgggcaggccgacgacaacgtcgaagcgacctatccggcgacgccgctgcaaagc
ggtctcttgttccatagcctgatgcagtcggggcgcggtgtttacgtcaatcagaagcgt
ctgacgttgcgcggttcactggatcacgaacgcatgcgggacgcgtggacgcgggtaatg
gcccgccacgcgatcctgcgaacgcacttcagttgggcgcacggcggcgatgcgatgcaa
gtcgtctcccgtcacgttgcgctgccttacacccggcatgactggtccgctggcccccaa
gcgacttacgacgcgcgcctgcacgcatggcttgccgacgacctcgcgcaaggcttcgac
ctcgctgtcgcgccgttgctgcgagtgaacctgtttgcccgtcccgacggcctgaccgac
ctcgtctggaccgaccatcacgtgctgctcgacggctggagtgctgcgcaactgctcgcc
gaagtcctcgcaatctaccggcgcgagacgttacccgaggccgcgtcgacgccgcagtat
ggcgattacgtgcactggctcacgacacaaccagaccatgccgactactggcaagctcgc
atgcaggcgctggatgaaccggcgacgctcgtcgccagcctgccgtccgctcagggcggg
cacgatgcgacgtcgggtccgttgctgcaagtcgacgacgtgctcgacagcgcgatggat
caacggctgcgcgaggccgctcgccagcaccgtgtcacgctgaacacgatgattcaggcc
gcatgggcgctgctgacctcgcgttacgggcatcggtcgcaagccgccttcggggtcacc
gtttccggccgggagaacgatctgcccggcatcgaccgcacgctcgggctgttcatcaac
agtttgccgatgtgggtcgacgtgcccgctgccgcgacgatttcagcgtggctacaggac
gtgcagcagcgcggcacggcattgcgcgcggtggaaaccacgccgctgcgtcaggtgcag
cagtggagcgggcgcgctgccgaggcgctgttcgacaccctcgtcgtgttcgagaactac
ccgatcgacgctaccgtacgggccgacgacgcgtcgctctcgctggcggccttcgccacc
acggaacagacgcattacccgctcgtgctcgcggtactgcccggcgacacgctgacgttg
cgctggaaggcgaaagcgtcgcgcatcgacgcgcgcacgttggcgcaattgcaggcggat
ctgcgcgcaattctcgatcaactgtcgagcacattggacgccggatcgacacatgtcggc
acgataacgctggccggtcagaccgtgccgtcgtcattgacccgtcatgaattcacaccg
gtcatgcatcgcattgccgcgcaggcaaaggccacgccgcaacgcccggccatccattgc
gaaggggtgcgttggtcatatcgcgaactggacgctgccgccaaccgcatcgccgtggcg
cttgtcgcggctggcgtgcgcgccgacgaacgcgtgggcctgtgcgtcgagcgttcgccg
tggatgaccgctgcgctgctcggcgtcctgcgggcagggggcgcgttcgtgccgctggac
ccgtcgtatccgtccgatcgtctggtcttcatgatggaagacgcgggcgtacgccgtgta
ctgaccgacgccgctacggcgcaggcgatggcctcggtactcgacgggcacgaggtgatc
gtggtcgacacgctggacccggccgatagcgccgtggtgtgccacgacgttcatcccgac
caactggcttacgtgatctacacgtcgggatcgaccggccggccgaagggcgtggcgatc
ccgcacggcgccttcagccagcacatcgatgacttcctgaacacctatgcgatcacgcaa
gacgacaagcagttgcaatcgtccacgatcaacttcgacgtggcgttgcacgaaatgctg
cccgcgctgtgcaagggcggacagatcgaaatgcgtgggccgcaggcgtgggatctggcc
accacgagccgccatctgagcgaggagggcgtgaccttctcgcgcattccgaccgcctat
tggcaacagtggttgcgcaatccgccgccgcgcgaggcacttgccgcgctgcgtcaaatc
acggtgggcggggaagggctgccgggcgacgcattgcgtcagtggcaggacggtccgctt
tcgggcattcaactcgacaacctgtacggtccgaccgaaaccacggtggcctgcatgtat
cggcgcacctgcgaggacgacacgcaacacgccatcgtctccatcggcgtaccgtatccg
tcgcgccgcgtgtatgtgatcgatgcgcatggcaacgaggcaccggtcgatgcgctgggt
gagctgtgcattgccggacacacgctggcgcgcggctatctgggccgggcgtcattaagc
gccgagaagttcgtgccggacccgtttgcgggcaatggcgcgcggatgtaccgcaccggc
gatctgtgccggcgtcgcgcggatggccggatcgactttctgggccgtctggacgctcag
gtcaagctgcgcggtctgcgcatcgaactcggtgagatcgacgccgtgcttcggcaggtg
ccgggcgtgcgcgacgctgtggtggcgttggtcggcgcaggcgagggcgcgcggctggcc
ggttacgtggtcggcgacgtggccgacgtggtgctgcgccgctcgctcgaacgcaagctg
ccggggcatatggtgccgtcggtgttcgtccacctcgatgccttgccggtcatgccgaac
ggcaagaccgaccgtgctgcattgccgctgccgcaagacatggcgtcgcgcgaacggcaa
gcgcccgtcgggcccgtgcaaacggcgctgcgtgacatctggcgcgacgtgctcgggcgc
gacgacgtgggcgtcaccgacaatttcttcgagatcggtggcgattcgattctgagcttg
cgtgtgatcgcgcaagcggcactggccggactgaagctcacgccgcgacatctcttcgat
gccccggatatcgaacgtctcgccctgttagccgagccgctgcatgcgagacccgcgcat
gtcgagtctcgcgaaccgttgccgttgacgccgattcaggccacgttcttcgatcgtcac
ccgcacggcgaggcgcattggaatcaggccgtgctgctgcaaagcgaatcgctgcccgat
gccgccgcgctgcgccgcgccttggatgccctcgttcaggcccacgacgcgctacggctg
cgtttcgtgcgcacgccttcgggttggcagcagcaggtggttgccgtggatgcgcacaat
ctgctcgaaacgctcgaccttcgcggcgaacccgactggcgtgctgccatcgaacgcgaa
ggctcgcgtgttcaccggtcgctcgacatcgggcaagggccgttgctccgggcgttgctc
atgcatgccccggatggcgcttatctgctgattacgattcatcacctcgccgtggacggc
gtgtcgtggcgcgtgctgctcgatgagcttgagcgtggctatcatgcagcgcacgaaggc
cgggccatcgagctttcggacaacacgccgtggagcgtgtgggtgcaggcgtcgaccgcc
catgcggcgtcggcagacgtcatcgacgagctgccgtggtggcgcaatgcactgagcggc
gcgagcccgctgttcggcgccacgtcgaaagggcggccgcgtcagacccgccacgcgttg
ctgggggcgcaagccacgcgccaactggtcgcgcagacacgcagcagtttcgggctgcaa
gtcgacgaagcgctgctgggcgtgctcgctcgcgcattgggcgacaccttcggttgcccc
gacgcgatcgtggccgttgaaggacatgggcgtgaatcactgggacgcgagtccagcgcc
gatctggatctgagtggcacgatcggctggttcacgacccgatatccggtccgtctgcct
gtgagcggcgcgcttgccgaccagctcatcgcgacaaaagatggcctgcgcgacgtaccg
aacaaggggctgcactgggggcttctggcgtggcatgcgcgcgacgacgtccgccgtgcc
gcagccgcgctgcccgtggcacaagtgggcttcaattatctcggcaatctggatcgggcg
gtcgccaccggcagcacgtttgcgctgtccacactcccatgcggggagatggccgccccg
gccccagcgccgttcgcgctcgatctcaacgcccgcattcaggacggcgcgctgtcgatc
acgtgggacttcgatcccgatatcgtcggcgctacgcaggtggaacgctgcatcgaacgc
tttgatgcccgcttgcaagccttcatcgaagcgacccgggaccgcgcgcgaatcttctcc
cgcagcgatttcccgcgcgccgcgctgaacgccgaacaatggcggcggctcgcgctggac
gccaccggggtagaggatgtttatcccgccacggcggtgcagcaagggctgctgtatcac
gacctttcgctgcccggcgagggcatgtacatcacgcagaagcgcgtgacgctgatcggc
gacctgaacatcgccgcgctgcgtcaggcttgggagcgggcagtcgcccgccacgccgcc
ttgcggactcgttttgcatggcaccacggcggcccgatcctgcaaatcgtgcagtcacag
gcgacattgccgttcacggtccatccggttccggcgggcagcacggatatcggcgcttac
gagcgtggtttcacccaatggcttgcgagcgatctgcgcgccggtttcgatgtagaacgt
gcgccgctgcttcgcgtcaacgtcttcatgcgccccgataatgccgctgatttggtgtgg
acagcacaccacgccatcaccgacggatggagcagcgcactgctgatggccgaagttgtc
ggcacctatcgcgccgtgcgtggcggcgacgaacggcaagcgagcgcggcaccggccgtg
ccctacagccgttacgtcgactggattgcgcgtcaaccgtcgtcgcgcgactggtgggtc
gaacaagccggagaggttgcggatcgcgggcagttgctcgcttatgcgtcttccgtatcc
cccgaggcaagcacggatgcattgaccttcgaagacgtcttgcccgacgcactgggcatc
aagctggtcgaagccgcgcaacgtcatcaggtcaccatcaatacggtgatgcaaggcgca
tgggcgctgctgatcgcacaacacagcttccgtcaggacgtgacgttcggcgtcacggtc
tccgggcgtccggcctcgttgcccggcgcgcaggaaatgctggggctgtgcattaactcg
ctgccgctgttcgtgacggtgaagccgtcgcaggacgttggcgtttggttgcgctcagtg
caggcgcagaacgtttcgctgcgtgagcacgaacacacgccgctggcgtccgtccagcaa
tggctcggtttgaacggtacggcgccgttcgatagcctgatcgtgtttgagaactacccg
gtcgcggccggtttgctcgacggcgacgccacgctgcgtgtggggcaggtgcaaggctgg
gagcgtacccactatcccgtcacgctgacggtcgccacacgcggcacgcccaccttgggc
tggcgcttcgacacgagccgttgctcaggcgaagacgccgcgcagtggcgtcgtcagtat
ctgtgtctgctggaggcgatggcgaacacgccggtagtcggcagccgagtggctgactgc
ctgacgccgacggttgacacgcttggcgaattgggtgttgtgcaggccacggccttcgac
aatgcaacggtgcccgcacgcatcgcgcgtcaggcgagcctgacgccggatgccgaggct
ttggtgctcgatgaccggaccctgacatttgccggtctcgacgccgccgccaatggcttg
gcacgtcgcctcgccggaatgggcatcacgcccgaggcacgcgtcggtgtggcgatgacc
cggtccatcgacatggtggtcgcgttgcttgccgtcatgaaggcgggtggcgcctacgta
ccgctcgacccggcgtatccgccggcccgcattgcccacatgatcgaggacagcggcgtg
tcggtcgtgctgtcgcaggcggcagtatcgcttgcgttggccgacggcgtgcgacgtctg
gacatcgacgacgccgtactggccgtgcggcacacgctgccgccggaagtcgcgctgcat
ggcgacaacctcgcgtatgtcatccatacgtccggttcgacgggcgtaccgaagggcgtg
gcggtctcgcatggcgcactcacgtgccacgtcgacgcgacgattgcgtatgcaaagttg
agcgccgcagatcgggtgctgcaattctccaccgtcaacttcgacgggttcgtcgagcag
cttttcccgagtctgtgcgtgggcgcgacggtcgtgttgcgcggcccggatgtctggtct
agcgacgaattcgttgcgcgcgtgcgccgtcatggcatcaccgtggcgcacttgcccaca
gcctactggcatgcgctgacgcaagacctcgctgacagcaccgaaagcctcgcgccgttg
cgcgagttccacgcgggtggcgaggccatgtccgcgcaggcgctgcggcgcacgcgggaa
agcgctgcgctggcgcccgtcacgctcatcaacacctacggtccgaccgaggccacgatt
acggcaacggtcttcgatgccgatgagatcggagcagacgcgctgccgtcgctgtcggcc
tttgtaccgatcggacgtgcgttgccgggccgccgcctgtacgtggtgtcgcccgatcta
tcgcgggtgccgcatggcgcaccgggtgaactgctaatcggcggcgagctgctcgcccgt
ggctatctgaaccgcccggggctcagcgccgagcggttcgtaccggatgcgttcggcggc
gagggcggccgtctgtaccgcacgggcgatctggtgcgctggcgtgacgacggcgcgctc
gactacctcgggcggatcgatcatcagatcaagctgcgcggctaccggattgaacccggc
gaaatcgaggcggcattgaccgcgcaggctggcgtacgcgaagccgccgtcgtggttcgt
accgaagggacgcgagcccgtctgatcgcctacattggccgtgacaccgcgcagccagtc
gacggggcacaacttcgcgacgccttggccacgcggctgccggagtacatggttcctgag
acggtcgtggtgctcgatgcattgccgctcaccccgggtggcaaggtagatcgtgtcgcg
ctgccggaccccggctcggcctcagcgacattcgaagcgccgcaaggcgaggccgaacgc
gtgctggccgacctgtggcagacggtgctgagcgtgccgcaagtgggccgtcacgacaac
tttttcgccctcggaggcgattcgatcctgagcctgcaagtcgtcgcgcgtgcccgtcag
gccgggctgacggtatcgccaaagcaattgttcaccgcgccgacgctcgccgcactcgct
gccgttgccacgcaggcggggacgaccggtgcggtgcgcgcgccaaccgacgacgccccc
ggccacgtgccgctgctgccgattcagcatgcgttcttcgccacgggcatgcgtgccgtc
caccactggcatcaggcgttgttgctgacacctgccgagccgctcgacgtcgaagcgctg
cggcaggcgctcgtgagtgtcgttgcacatcatgcggcgctgcggatgagattcgtgccg
gatacggctgcggcgggtggttggcgtcagtcgtacaccccgttcaatcgcgaatctgcc
gagggcatgctgtggacccgggtggcggcaaatacccatgacgtcgaagctatcgggaat
gaggcgcatgtcagcattcatctgacagatggcccggtactgcgcgcagtgctgatcgcc
atgccggatgccagccagcgtctcttgctcacggcacaccatctggtggtcgacggcgtg
tcgtggcgcattctgctgggcgatctgcgcactgcgtatgacgcgtggcgcgctggacgg
gcgcctgcgctcgccgcaaccggcacgagctatcgcacgtgggcggagtcccttgttgat
ggcgcgtcgcgcagcgaacagcgtgacgaactggcctactggtcgagccttcgcggcgca
acacacctgcctgttgtcgatactgacgcaccgtcgctggccggtgatctgacgcgtgtc
gagcgtcgtttcaatcgcgacatcacccaacagcttttgcaagacgccggtgtcgcctat
cgcacgcaaaccggcgagcttctgcttgtcgctgtcgctcgcgcattgcaggcgtggacc
gatgccccggactatgtcatcgcgctggaaggtcacggccgcgaaccatggagcgacgac
gtcgatctgtcgcgcaccgtgggttggcacaccagcctttatccgtttgcggtgcaggcg
cagggcgatctgcgagacgcgatcctccggaccaaatcggccctgcgtgccgtgccgcag
cgcggtcttggcttcggcgtcatgcgatggcttggcgacgacgcaacccgcgaagcgttg
gccgctgtgcctgtgccggcggtcgtcttcaactacctcggccgctttgacagcgcattg
gggcaagactggcagcccgccggggaagccctcggacagaccgttgccagcgacacgccg
ctcacgcatgacctcagcatcgatgccaaggtcgtgggcggtgaactgaacgtggcgctg
tcgttcagtgcccgccgtctcaagccgcagggcgtggaggcgttggccgctgccatcgac
accgagttgtccgccatcctcgcgcattgtcttgacgagactgccgctggtgtgacgtca
ggcgatttcccgctggcggccttggacgatgcgatgcttgcgacgttgccgctggcatgg
cgcgacgtcgacgatctctatccgctggcgccgatgcaggcagggttgttgttccacgcc
atggttgacgggcagggcggtgcgtatctgaaccagatgcgcgtcgatatcgacgggctc
gacccggcgcgcttcgaagcggcgtggcagacggtttgcgcacggcatccgatgctgcgc
accggttttgtcaccacgggcagcaagttgctgcaatgggtggcccgccaagccccggtg
ccgttcctgcatctggactggcgtgagcagaacaccgcgccgtctgacgcgacagatacg
ctcgacgccctcgcattggcccaacgtgagcaaccctttgatctggcggtgccgccgctg
caacgcgttgcactcgttcgaacgggcgtggcgaaatatcacctgatctggacttgtcac
catctgctgctcgacggctggagtacgtctcgcctgatcggcgaagtcatgcggcactat
cacggcgagccgggcagcgcgccgacggcaacgttccgcgactatgtccagtggctggcg
ggacaaggcgccagtacctcaggtagcgcggcggtgttctggcgggacacgctgggcgtg
ctggacgaaccaacacgtctcgcgccccgcgagttgccgcctgccgccgcccgtgacgac
tttgcaacggaagtcacagaactcgatgccgccacggtcagccaactgaatcgcttcgcc
gcgcgcgagcgcgtcaccgtgaacaccctcgcgcaaggcgcttgggcgctgatgctgcat
caggctacaggccatcagcacgtagccttcggcacgacagtcgctggtcgtcctgcatcg
ctgccgggtgccgataccatcgtcggtctgttcatcaacaccgtgccggtggtcagtcaa
cgcccggaacgcgatgcggcaggcgactggctgcgtgacttgcagtcgcgccgggcacaa
gcgggtgatttcgagcacacgccgttgcacgacattcaacgcgctgccctggtgacgggc
gcgctgttcgacacgctctttgtcttcgagaacttcccggtggatggcgcactggcggaa
gcggcggcgcatggtttgacgcttacgggcgccagcactgacgagtccacccattacccg
ttggccgttacggtcgtgccgggcgatcagtggcgcattcgatggagctaccggacacag
gcgttctcgcgcgccgacgtctcggcgctgtcatcgcgcttcgcccagacgctccgggcc
ttgtcgggcgacgggttacttgccgccgccgatgcattgcggatgacatcggacgccgcc
cagcacgttgccgcattgggtgcgccacagccgctgccgatacatgacgcacgctgcctg
cacgagcggattgccgcgcatgcgttgcaatcaccgaatgcgacggccttgcgcgacggc
gacacgatcgtcacttacggcgaactcgacgcgcaggcgaatcgtcttgcgcatcgtttg
ctggcacgcgggatcggtcccgaggcacgtatcggcatcggcatgacgcgttcgccgcag
atgatcgtagcgatgcttgctaccctcaaggcaggtgctgcctatgtgccggtcgatccg
gcgtatccggcggagcggttgtcgtatctgatggccgattcgggcatgcgctgtttgcta
acgcgttcggtggatcgcgatctgctgccggtgccggaggggctggcagtcatcgatgtc
gcggacgaggcgctgcctgacgacgtagcatcgtccaacgcaccaatggtcgccgtccat
ccgcgtcagctcgcgtatgtgatctacacctcgggctcgaccggcaagccgaagggaacc
caactcacgcacgccaacgtcatgcggttgcttgaccagacgcaggcacgcttcgggttc
ggcgagcgcgacgtctggacgctgttccattcgttcgctttcgatttctcggtgtgggaa
atcttcggtgcgctttgctacggcggcacgctggtcatcgtgccgcatgccgtgtcgcgt
gcccccgccgagttcgccgccttgttgcgcgacgaaggtgtgacggtgctgaaccaaacg
ccgtcggcgttccgtcagttgttgcagatcccgtcgatgtacgaacccgggctgcgtctg
cgcacgatcatcttcggcggtgaagcgctggaagtcagagcgcttgcgccgtggttcgcc
cactacggcgaccatggtccggcgctggtcaacatgtatggcatcacggaaaccacggtc
cacgtcaccgcccgcgaactgacgccacaagacgtagatgccgaacgcagccctgtgggg
cgcccgatcggcgatctcggcctgtacgtgctcgacgcttggggcgaacttgcgccgctg
aacattcccggcgaactccacgtgagcggtgccgggctagcgcgcggctatctggggcgt
gccggactcacggcggaacggtttgtaccgaatccgtttgcgcatgacggcggccgtctg
taccggacgggcgacctcgctagttggaccgacacgggcgaactcgtctaccttggccgc
atcgatcagcaggtcaagattcgcgggtatcgcatcgaactaggcgagatcgaggcgcaa
cttctgagggtgccgggcgtcacgaatgctgcggtcattgcgaccagcggcgcggccgat
gcccgtctgctcgcctacgtctgcggtgccgacacgctcgaccccgcctcagtgcgtgtc
gcgctgtcgcagctattacccgactacatggtgcccgccagcgtaagcgtgctggcagcg
ctgccattgaccgccaacggcaagctcgaccgtgccgcactgcctgcgccagaagcgcag
cacgccgcaggcccggcaccggcgggcgaaacgcaggttgccttggcggccatctggtcc
gacttgctcggcgtggcgaaggtgggtcgcgacgacaatttcttcgatctcggcggcgac
tcgattcttgtgctcaaggtggccgcccgcgccgcacaggccggtattacgctcaccgcc
cggcaatgcttcgaagcgccgacgctggcggcactcgcggcggccgctgacgttgccctc
ggcctcggactgccggtcgacgaagccgccgcaccaatcgttcgcctgacggatcgcaca
catttgccgctctcgcacgcgcagcagcgcttgtggttcctgtggcaattgcagccgcaa
agcacggcctatcacgtcggcggtgccttgctcatgcgcggcgccttcgatgccgcagcg
gcgcgcaacgccttcggctggcttgtgcagcgccatgaagcgctgcgcacgacgtttgta
atgtccgaacgcggcgaagcgacgcaggtcgtgcacgacgcgctgccttgcgcgttcgac
catcgcacgggggatgaagccagtgcccgcgccttcgccgccacatggatggctgcgccg
ttcgatctcgtgaacgggccgctgcttcgcgtcggtgtggtgagcatggccgacgacgcg
catgtgctcgtcgtgggcatgcaccacatcgtgtccgacggctggtcgatggacatcttg
ctgagtgaatttgtcgatgcctatcgtgccgcgttggcgggcgaagctggcgtggcaccg
gactgggcgccgttgcccgtgcagtacgccgactatgccgtctggcagcgtgattggctc
gacgccggcgcgcgcgatgcccaactgacgtggtggcgcgacgcgctggatggcgcgccg
ggccaagtacaaccggtgctggatctgccgacggaccgtgcccgtcagtcgctcggcgac
tatcacgcggcgcgcgtgtcggtcgatcttccggcaaccgtggcgtccggcgtccgtacc
ttggcccgtcggttcgccaccacgccttacgtcgtgctgctcgcggcgttccacgccttg
cttcatcgccatacgggacaggacgacattcgtgtcggcgtgcccgtcgcgaatcgcgag
cgtgccgaggtcgccggtgtcatcggactgttcgtcaacacacaggtactgcgcgcacaa
ctggattcgcgtgtgacagcggccacgctgatcgggcaaatcgacgaacgggcccggcag
gcgcgtctgcatcaggacctgcctttcgatgcactggtcgatgcgcttcagcccgagcgc
agcctgtcgcacacgccgctgttccaagtgatgttcaaccacgagcgcgatgaccaacgg
gcgctggcgcaattgcccggcgttcgcgtggagccgttcccgctcggtattggtatgggc
gaagcgcagtttgaactgtccttgacgacgagtgaaacgccggagggggcaatccgcgcc
gatctcgactatgtgcgcgaattgttcgacgccgaaacggcggagcagttggccgcgcaa
tacgtgcgccttctgtcgggattcgccgagacaccggaccgggcgatcggtgatattgcc
ctgcacgacgtacaagggctcgacgctttgctggcgtgggggcgcaacgacgaaggcccg
gcctgcgcttcaccggtgcacgagacgattgcccgtcaggcggcagcaacacccgacgcc
atcgcggtgattctggacgacacccggctcacctatggcgagctggcgttacgcgccaac
cggcttgcccagcacttgcgcggcgtgtgcaccgcaaccggggaggtgcgggtcggcatc
gcaatgcgacgctcgctcgatctcgtcgtggcggtgctggccgtgttcaaggcgggggcg
gcttacgtgccgctcgatccggattacccccaggcgcggctggccgatatcgtgtcggac
agcggactggccgccattctggcccatgcgaacgtgctcgaccggttaccggcgaacgtg
gcattgccggtcctctgcgtcgacacgctggcgctcgatcagggcgacgacggcaatgtg
tgcgcaccggacgtgcgcgtccatccggcacagttggcgtacgtgatccacacatcgggg
tcgaccggcaaaccgaagggcgtcgccatatcgcatggcgtgcttgcacgtcacgtcgac
gtgtcggcccgcttcgcaggcatcagtgccgccgaccgcgtgctccagttctcgaccatc
aatttcgatccgttcgtggaacaactattgccgtcgctttgcgtcggcggcacggtcgtc
ctgcgcggacccgccgtatggagcgctgcggagttccgtgagcaggtcgaacagcacggc
attacggtggccgacctgccgacggcgtactggcagatgatcacgcgcgaactgggcgat
ggcgaagcccttgccggtctgcgcgaggtgcatgccatgggcgaggcgatgccgctggag
acgttgcggcaatggcgcgccagccgtgccttcggcggcgtgcggttgttgaacacctac
gggccgaccgaagccgctgtgacggcaacgttgttcgacgcgaccgctgccgacgttgat
gcgttgcccgccttggtgccgatcggcgtgccgctgggccaacgctcgttgtatgtggtc
gatgcggacttccagcttgtacccgcaggtgcaatcggcgagctgctgatcggtggcgac
ttgctcgcgcgcggctatctgaatcgcccggacctgacggccgagcgcttcgtgcccgat
ccgttcgggggcagcggaggacggctgtaccgcaccggcgaccgggtgcgctggcgtgcc
ggtggccagcttgaataccttggccgtaccgatcatcagatcaagattcgcggcttccgt
atcgaaccgggcgaaattgaagcggcattgctcgcacaacccagcgtcggtcaagcggtt
gtgttggcgcgggacgtcgatggcgcgacgcgtctcgtgggctatgtcacgctcgccagc
gaccacacgggcagtgagcccgatgcggcgtcgctgcgactcgccctcggcgccgtgctg
ccggactacatggtgccatccgcattgatggtgctcgacgcgctgccacagttgccgaac
ggcaagcttgatcgtcatgcactgccggtgccgacgttcgcgaagcaagcgttcgaagcc
ccgcaaacggcactcgaacagtcgctggccgatctttggcatgaggtgctgtcggagggc
cgtcgcgacacggccagcgttgtacgcgtaggccgtcacgacaatttctttgcgctcggc
ggcgactcgatccagattctgaagatcgtggcacgggcggccaaccgtgggatcgcactt
tccccacgccagatgttcgagtcgcagacggtcgcggcacttgccacatcagtggtgtcg
gcgcaggggcaacagaccggcagcgcatgccacacgacggcgtcgccgatgctgccgctc
atcgaccggtcacacctgccggcgtcgcacgcccaacggcgcatgtggatactctggcac
ctcgatctgcaaagcagcgcgtatcacattgccgatagcgtgcgtgtgcgtggcaagctc
gatattggtgcgcttcaggcgacgttcgacgccatcgtggcgcgacatgagagcttgcgg
acgacgttctcgcaggacgccgatggtgacgtgcgccagcttgtccacccggcgacgccg
gtagccatcgtgcgcgacacgcatgccccggcacaagcccgctcatgggcggccgcattc
atggcgcagccgttcgatctcacacaggggccgctcttgcgtgtcgggctcgtcacgctc
gggacggacgaccacctgctggtggtggcgatgcatcacatcgtctcggatggatggtcg
gtggacgtcatcctcgacgagttcgccatcggttaccgggcagcgattagcggcgagtcg
cctgaatggcgcgcgttgccggtgcagtacgccgactatgcatcgtggcagcgcactgtg
ctgaacgacgctgagaaggaacgtcaactggcgtactggcgagaggcgctcaatgacggt
gcgcagacgctggcgctgcccacagaccgtgcgcgtcaggccctcggccgctatcgcgcc
gcgcggctcccgatcgcgttgccgcctgcattagccacacaactcggggcgttggcccgt
cagtacgaaacgacagtgttcacggtgctcctcgcggcgtttcaagcggtgctgcatcgc
cacaccgggcagcaggcgattcgcgtcggcgtgccggtcgcgaaccgtgatcgggcggag
gtacagggcctcatcggactgttcatcaacacgcaggtgctcggcgtcacgatcgcgccg
cgcatgaccctcgacgcattgctgcgtcagactcgcgagcgtgtgagcggggcgcagcag
catcgcgaattgccattcgatgtccttgtcgaagccttgcagcccgagcgcagcctcgtg
cattcgccgctatttcaggtgatgttcaatttcgagcaggaagaccgccgcgcgctgtcg
tcgctgcccggcctgaccaccgagcgctttgacgcggtcgaccaagcggcacagttcgat
ctcacgctgaacctgcgcagcacaccggacggtgtcatcgacggcagttgccaatacgcc
cgggaattgtttgacgaagccacggtggcgcgcttcatgacgcattacgtggccgtgctg
acggcgttggcgacgtcgtccgggcagaccatcggcgagattacgctcgccgacaaggcc
gaagtcgaacggctgcgggcttgggggcagggtgaaagcacggccaccggtgaggtcagg
ccgatggccgtgcacgtcgcgattgccgcgcaggcggctcgcacgccgacggccattgcg
ctcgtgctagacgacgacagcctgacctatgccgaactggacgctcgcgcctgccgtctt
gcgcggcatctgcacgcggcgggcgtgacccctgacacgtgtgtcggtattgccatgacc
cgttcgctcgacatggtggttgccatgctggcgatcctcaaggcgggcgccgcctacgtg
ccgctcgacccggactatccgctgacgcgtctgacctacatgatcgaggacagtggcatc
cgggtgctggtgagagacacggcggtcatcggcaagctgccgcaactcgcacaagtgccg
ggtgtgaacacacttaatgccgattcgctggatctgcaatccggcactggtgcaaccacc
gcaccggcgacaccggtgttgccggcgcaactggcgtacgtgatctatacgtcagggtcg
acggggcaaccgaagggcgtgggcattgctcacgcggcgctcgccgggcatatcgacgcg
accatccgctatgcgcgtctgacgccgtcagaccgcgtccttcagttctcgaccgtcaac
ttcgacggcttcgtcgagcagctattcccgccgctctgtctgggtgcgaccgtcgtcatg
cgtggccccgatttgtggacgaccgacgagttcgtggcacgcgtggctcgtcatgggctg
actgtggcgcacttgccgacggcctattggcacgtgctcacgcaagatctggccgacagc
aaaacgtcgctggcaccgctgcgggaattccacgcgggcggcgaggcgatgtcggcacac
ggctggcggcgcacgcaagcaagcgccgcgctcgcaccggtaacgttgatcaacacctac
gggccgaccgaagcgacgattactgcgacggtgtatgacgccaccgcggtgaccgatgtc
accgccgcgacgttcccgggcacggtgccgatcggacggccgttgcccggacgcagcgtg
caggtggtcggccccgacatggccgcggtgccacaaggtgcagtgggtgaactggtcatc
ggcggcgatcttctggcgcgcggctatcttggccgaccggcgctgacggcagagcgcttt
gtgccggaccccgagcgcaccgatggcggccgctgctatcgcactggcgatcttgtgcgc
tggcgcgccgacgggcaactcgactatctcggccgtatcgatcaacaggtcaagattcgc
ggcctgcgtatcgaactgggcgaagtggaagcggcgctgctggcgctcgccggtgtgcgg
gaagccgtggcgtctgccgtgcaagccacgtccggtgagggcaaccggctggtcgcgtgg
gtagtggcagaggcgggtgcctcactggaagcctcggtattgcgcccggcactggcccga
accttgcctgcatacatggtgccggaagccatcgtggtgctcgatgcgttgcccatgaca
ccgggcggaaaggtcgaccgtcgcgcgctggtgatgccgtcgggcgatgcgtcgcaatct
gtcacgatggcagcgatcccgaggggggacaccgaaaccgcgctcgccgcgctgtggcag
tcgctgctcgatgtgccgttcgtgggccgcgacgacaactttttcgcgctcggcggacac
tccctgagcgcgctgcaactggtttcgcgtgtgaagtcggcactgggccgccagttgtcg
ttgcgcgatgtctttgctgcaccgacgctcacagcgctggcgcagcaactcgaattggcg
cctcgcgttgcggttgatgggcctgcgctggtcagcgtgccgcgcgaagagcgcatgccg
ctctcgccgacgcaataccgcctgtggctggccgacaagctggccagccctgacgacgct
gcgtcgtacacgctggcgaccgccatgcgggtcacgggcaatttcgacgtggacaccgcc
cgggcggcgatggccgcgctcgtcgcgcgtcatgaagtgcttcgcacgtgctatccggat
gacgacggcgtgccgtatgcgcgcattgcgccgatgggtgaggcggatatcgaggttgtc
gatctggacggggagtcggcagacgcgcaggaaattgccattgctgacgcgatggccgcc
cagtcgcggcaccggttcattcttgcctcgggaccgctggcccgcattcggctgctgcgg
ttggcgcagaacgatcacgtcgtgctgttcgccgtgcatcacatcatcgcggacggttgg
gccatgagcgtgctcgtcggcgagttcgcgaacgcctatgcggccattcgcgacggcgtg
gcgccggcgttcgcgccgatgccagtgcaatacgtggactacgccgactggcaacgcaag
gctgtggatggtgcgtccggtgaggtgttgcgcaactactggcgcgatgccttgcaaggt
gcgcccgctgcgttgcgtctggacacggatcacccgcgtccggtggcgacatcgaccgca
ggcgcgggtgtgccgttcgtcctcccgcaatcgctcaacgcaccgctgcaagcgttcgcc
caacatcacggcacgacaccatcgaccgtgctgctcgccagctatcaggcgttcctgcac
cggttgaccggcatggatgatctcgtcgtcggggtggattcggctggccgtcacgatgaa
gcgctcgaacccatgctcggcttcttcgtgaacgtgctgccggtgcgctcacgtgtcgat
gcccgtgaaccctcgttcggtgcactcacgggcaggacgcatgacgcaatgctcggcgcc
atcgcccacgaagcgctgccgttcgagcgcatcgtcgaggcgtcgggcgtgggccgtgca
tcagggcgcagtccgctcgtccaaaccctctttgtcatgcagaacacgccacgcggcgcg
ctcgccattgacggtctgcacatcgacccgatcaagcaagcgagcgcgtcgtcgaaattc
gacatggcgctatttctgcatgaaaccccgctcggctttgccggcgaatgggtgtttgcg
actgatctgttcgtgcacgccagcatcgaacgctttgtcgccacctggctcaagcttctg
gagacctatctcatggaacccgataccccgacacccccgacgcctccgatgaccccgccg
ctggcacaagacgccgcacgcacgcgtgacgccgcgcgcgccgcgaagctcgaaaaactc
ggcgcactgggcggtggacgcaagcccgcccgtccagtggcgggtgctgccctcggcaac
accggcaatggcaccacgcaggactatcaagtccgcatcacgccgatgcaggcaggcacg
ggctttcctgccttgatcgaaccgcagcatgcagacctcgacccgtttgtgtgggcggcg
cggcatcgcgagcagatcgatatctggctggcccgccacggcggtctgctgctgcgcggc
ttcgccatcgagggaccgcgccagttcgagcgcttcgtcgaagccatcgtgcccgagctt
tacggcgactacggcgatctgcccaagaaggaagagggggaccggacgtatcggtcgacg
ccttaccctgagaaggaaatgatccttttccataacgagagctcgcaccttgagcaatgg
ccccgcaagcagtggttctattgcgagttgccctcgcaggtgggcggcgcgacaccgatc
gtcgacggccgcgagatgctgcgccggttgccgcctgacgttgtagatcgcttcgcgcgg
ctcggcctgtgctacgtgcgcacgttcatcgaagggctggacgtgccgtggcgtcagttc
ttccataccgacagccgggaagacgtcgaagcccgctgccgcgccgtcggcacacaggtg
cgctggtttggcgacacgttgcagacggtctcgcgcggcccgggtgtgctgcggcatccg
gtcaccggcgaactggcgttcttcaatcaagtgcaactgcatcacccgtacttcctcgcg
ccggacgtgcgtcagcatctgatggacattgccggggaagaccggttgccgcgcaacgtc
ctgtatggcgatggcacccccatcgacgacgagacgatggcgctgatcggcaaagcctac
gaggcatgcgcgttccgcttcgactggcaacggggtgacgtcgtcatgctcgacaacctg
ctcgtcgctcacgcacgcgacccttatcaggagccgcgcaagatcgtggtcgcgatggcg
cagatgatgtcgcgcgacagcgttcccgcgacgaacgtggatagcggcgcggcgagtacc
gtcaacccgccgatctcgatgccgctgggtgatgaccatgcatga

DBGET integrated database retrieval system