KEGG   Polynucleobacter asymbioticus: Pnuc_0039Help
Entry
Pnuc_0039         CDS       T00502                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
pnu  Polynucleobacter asymbioticus
Brite
Translation factors [BR:pnu03012]
 Eukaryotic Type
  Elongation factors
   Pnuc_0039
 Prokaryotic Type
   Pnuc_0039
Mitochondrial biogenesis [BR:pnu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Pnuc_0039
Exosome [BR:pnu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Pnuc_0039
  Exosomal proteins of breast cancer cells
   Pnuc_0039
  Exosomal proteins of colorectal cancer cells
   Pnuc_0039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ABP33261
JGI: Pnuc0039
UniProt: A4SUU7
LinkDB All DBs
Position
42390..43580
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSKAFGGEAKAYDQIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIVVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIIQGSAKLALE
GDEGPMGKEAIMKLAEALDTYIPTPERAIDGAFLMPVEDVFSISGRGTVVTGRIERGIVK
VGEEIEIIGIKPTLKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREEVERGQVLAKPGS
ITPHTHFTAEVYILGKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVT
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKILA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaagttcgagcggacaaaaccgcacgtaaacgtaggcaccatcggtcac
gttgaccacggtaaaaccacattgacagcagcaattgcaaccgtgctttctaaagcattc
ggtggcgaagcaaaagcatacgatcagatcgatgctgctcctgaagaaaaagcacgcggt
attacgattaatacagcgcacgttgagtacgagactgcaaaccgtcactacgctcacgtg
gattgcccaggacatgctgactacgtgaagaacatgattactggcgctgcccaaatggac
ggcgctattttggtttgttctgctgctgacggcccaatgccacaaactcgtgagcacatc
ctcttggcacgccaagttggtgttccttacatcgttgtgttcctgaacaagtgcgacatg
gttgatgacgctgaattgttagaactcgttgaaatggaagttcgtgagcttctatctaaa
tacgacttcccaggtgacgacacaccaatcatccaaggttctgctaagttagcccttgaa
ggcgacgaaggcccaatgggtaaagaagccatcatgaaattggctgaagcattagataca
tacatcccaactccagagcgtgctattgatggtgcgttcttgatgccagtagaagacgtg
ttctctatctccggtcgcggtactgtggtgactggtcgtatcgagcgcggtatcgttaaa
gttggcgaagagattgaaatcattggtattaagccaactctcaaaacgacttgtactggt
gttgaaatgttccgcaaattgctcgaccaaggtcaagcaggcgataacgttggtatcttg
ttacgcggtacaaaacgtgaagaagttgagcgcggccaagtattggctaagccaggttca
atcactccacatactcactttacagccgaggtgtatatcttgggtaaagacgaaggtggc
cgtcatactccattctttaacaactatcgtccacagttttacttccgtactacggacgta
actggttcaatcgagttgccaaaagacaaagaaatggtgatgcctggtgataacgtaacc
attaccgtaaaactcatcgctcctatcgcgatggaagaaggtttacgttttgcgatccgc
gaaggtggccgtactgttggcgccggcgtggttgcaaagattttggcttaa

DBGET integrated database retrieval system