KEGG   Polynucleobacter necessarius subsp. asymbioticus: Pnuc_1816Help
Entry
Pnuc_1816         CDS       T00502                                 

Definition
(GenBank) pyruvate kinase (EC:2.7.1.40)
  KO
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
pnu  Polynucleobacter necessarius subsp. asymbioticus
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pnu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pnuc_1816
   01230 Biosynthesis of amino acids
    Pnuc_1816
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pnuc_1816
   00620 Pyruvate metabolism
    Pnuc_1816
  Nucleotide metabolism
   00230 Purine metabolism
    Pnuc_1816
Enzymes [BR:pnu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     Pnuc_1816
Exosome [BR:pnu04147]
 Exosomal proteins
  Proteins found in most exosomes
   Pnuc_1816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(1896032..1897468)
Genome map
AA seq 478 aa AA seqDB search
MLRATKIIATLGPASEKPEVLREMIRAGVDVVRMNFSHGTVADHKARHDLVRSISAEVGK
EVGIMADLQGPKIRVGKFEDSKILLQEGEKFILDVACELGNQGRIGLDYKELPNDVKPGD
RLLLNDGLVVLRVESVKGGEIFTLVEQGGPLSNNKGINRAGGGLTAPALTEKDIADLDAA
IAMGVDFLAISFPKDGADMAYARRLADAASVKYGVGKVRTIAKVERAEAIEAEALKSIIA
ESDGIMVARGDLAIEVGNAAVPALQKRMIKWAREADKFTITATQMMESMISAPVPTRAEV
SDVANAVLDGTDAVMLSAESAAGSYPVQTIKAMAEICIEAEKSDPVKLDTDFLDQTFARI
DQTIALGALFTAHHLHANAIAALTDSGSTAVWMSRHNIHVPIFALTSKIATQRALSTYRN
VTPIGLDYTKERDTALQEVETCLKKAGAVKAGDTVVLTSGEPMGEPGGTNSLKIIHVK
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgctaagagcaaccaaaatcattgcaaccttagggcctgcctcagaaaagcctgaagtg
ttacgcgagatgattcgtgcgggcgtagatgtagtgcgtatgaatttttcacatggcact
gtagcggatcacaaagcacgtcatgatttagtgcgcagcatttctgctgaggtaggtaaa
gaagtcggaattatggccgacctacaggggccaaagattcgagtaggaaaatttgaagac
agcaaaatcttgcttcaagaaggtgaaaaatttattttagatgtggcatgcgagctcggc
aatcaagggcgcataggactggactacaaagagttgccaaatgatgtgaaaccaggtgac
cgtcttttattaaatgatggcttagtggtgctgcgtgttgagagcgtcaagggcggtgag
attttcacgttagtagagcaaggtggtccgctatccaacaataaaggtattaatcgagct
ggcggcggcttaacagcaccagcattaacagaaaaagatattgctgatttggatgctgcg
attgctatgggtgtagattttctcgctattagcttcccaaaggatggggctgatatggca
tatgcgcgtcgtttagctgatgcagcgagtgttaaatatggagttggcaaagtaagaacg
attgccaaggtagagcgtgctgaagcgattgaggctgaagccttaaagagcatcatcgcc
gagagcgatggaattatggtagctcgtggagatctcgctatcgaggttggcaatgcagct
gtgcctgcattgcaaaagcgcatgattaagtgggcacgcgaagccgataaatttacaatc
accgccactcaaatgatggagtctatgattagtgcacctgtgccaactcgtgcagaagta
agtgatgtggcaaatgctgtattagatggtaccgatgctgtgatgttgtctgctgagtct
gctgcaggttcttacccagtgcagacaattaaagccatggcagaaatatgcatagaggcg
gagaaatctgatccagtgaaattggatacagattttttagatcaaacttttgcgcgtatt
gaccagacgattgccttgggcgcattatttacggctcaccatttacacgctaatgccatc
gcagcattgacggattctggatctactgccgtgtggatgagtcgtcacaatatccatgtt
ccgatttttgcgctgacttcgaagatcgcaacgcagcgcgcattgagtacttaccgtaat
gtgactccaatagggcttgattacaccaaagagcgagatacagcattgcaagaggtggaa
acctgcctaaagaaggcgggcgcggtaaaggctggagataccgtggtgttgacctctgga
gaacccatgggcgaaccaggcggtaccaacagtctcaaaattattcatgtgaagtaa

DBGET integrated database retrieval system