KEGG   Paenibacillus odorifer: PODO_04360Help
Entry
PODO_04360        CDS       T03326                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
pod  Paenibacillus odorifer
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:pod00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PODO_04360
Enzymes [BR:pod01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PODO_04360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
996962..998953
Genome map
AA seq 663 aa AA seqDB search
MKRYDHVQMGVDYYPEHWDESMWEPDIKLMKETGVKVVRVAEFAWSRLEPTEGNYQFEWL
DRALNLFHQYDLQVVMGTPTATPPRWLTTKFPDVLPVFANGETFHPGVRGHRCYNSTSLR
EYGSRIILRLAERYSEHPAVIGWQTDNEFGMLDCHCDACNTAFRAWVQAKYGTLDEVNAE
WGTVVWSGEYSDWNELTVPLGGSPHQNPSFLLDFQRFQWDSVVAFQTAQINILRMICPEH
FITHNFHSYPQRLDMYAVGADLDVAAFDYYPNTSPTKQDTTPYSGALSLDVTRGIKRQNF
WIMEQLSGSPGCWMPMWRTPYPGLIRAYAWQAIARGADTVVHFRWRSATSGAEQFWHGLI
DHSNVPGRRLAEFTQLCHEVNRLSDKLQGTMLKNEVAILHSHEEKAALDIQPQAEGFDYY
ENIKQIHRAVTKLGIGCDVIDLRQPLDGYKVVIAPNLYLLDEEIVRNLEDFALAGGTLLI
TNRSGVKNINNIAVMQPLPGQLSYCTGVEVLEYDPIGAETHAIMDAEGNQYECTQWCDIL
RPVVAQPIAWYGDDFYRGTPAVTVNSFGKGQVYYFGTHAEEKYWSVLLENLTKEKGLLRF
EGLPNGVQASVRTGNQGSFLFLLNLSRESVIVPLPREYSSLLDNKIRSGELQLEPYGVEV
LEI
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgatatgatcatgttcagatgggtgtggactattacccggagcattgggatgaa
tccatgtgggaaccagatatcaagttgatgaaagaaacaggtgttaaagtagtccgggtt
gctgagttcgcatggagtcgactggagccaactgaggggaattaccagttcgagtggttg
gaccgcgcgctgaacctttttcatcaatatgatctgcaggttgtgatgggtactccaaca
gctacaccgccaagatggttaacgacgaaatttccagatgtgcttccggtgtttgctaat
ggagagacctttcacccgggggtacgtggacaccgctgctataacagcacatcactgcgt
gagtatggcagccgtattattctgcgtcttgccgagcgttacagtgaacacccggctgtc
ataggctggcagactgataatgaatttggcatgttggattgtcattgtgacgcttgtaat
actgcttttcgagcatgggtacaagctaaatacggaacactggatgaggtcaatgcagaa
tggggaaccgtagtttggagcggggagtacagcgattggaatgagcttaccgtgccgctg
ggcggatcacctcatcagaatccatcttttctgctggattttcagcggtttcagtgggat
tcggtggtagcgtttcagacggcgcagatcaatattttgcgtatgatttgtccagagcat
ttcataacccataactttcacagctatccgcagcgtctcgatatgtacgcagtgggtgca
gatctggatgtggctgcgtttgattattatccgaatacttcgccaaccaaacaagatacg
acgccttatagcggagcgctttcattggacgtaacccgtggcattaaacgtcaaaacttc
tggattatggagcagctgagtggatcgccgggttgttggatgccgatgtggcgaacccct
tatccaggactgattcgtgcctatgcatggcaggcgattgctagaggtgcggatacggtt
gttcattttcgctggagaagtgcaacttcaggagcagaacaattctggcacgggctgatt
gaccacagcaatgttccgggacgcagattagcggagttcacgcagctatgtcatgaggtt
aataggctgagcgacaagctccaaggaacgatgctgaaaaacgaagtggctatcctccat
tcccatgaagagaaggccgcactggatattcagccgcaggcagagggctttgattattat
gagaacattaagcagattcaccgggcggtaaccaagcttggcatcggctgcgatgttatc
gacctcagacaaccgcttgatggatataaagtagtgatcgctccgaatttatatttgctg
gatgaggagatcgtacgtaatctggaggattttgccctcgctggcgggaccttgctgatc
accaaccgtagtggtgtcaaaaatataaacaacatcgcagtcatgcaaccgctgcccggg
cagctgagctactgtaccggcgttgaagtgctggagtatgatccgattggcgctgaaaca
catgccatcatggacgcggagggtaaccaatacgaatgtacgcagtggtgcgacattctc
cggccggtagtggcccagccgattgcttggtatggtgatgatttctatcgcggcacaccc
gctgtaactgttaattccttcggtaaaggtcaggtttattacttcggaactcatgcggaa
gagaagtactggtcagttctattagagaacctgactaaggaaaaagggttgttacgcttt
gaaggattgccaaacggagtacaagcctccgtgcggactggaaatcagggaagcttctta
ttcctgcttaacctgagccgcgagtcggtgatcgttccgttgccacgagaatacagcagc
ctgctggataataagattcgatcgggagagctccagctcgagccgtatggagtagaggtg
ctggagatttga

DBGET integrated database retrieval system