KEGG   Polaribacter sp. BM10: BXQ17_00675Help
Entry
BXQ17_00675       CDS       T04746                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pola  Polaribacter sp. BM10
Brite
Enzymes [BR:pola01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BXQ17_00675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu LPAM_1
Motif
Other DBs
NCBI-ProteinID: AQS92671
UniProt: A0A1U9L3L5
LinkDB All DBs
Position
complement(156876..157397)
Genome map
AA seq 173 aa AA seqDB search
MKYLKKTSLFLLTIIILSACSSNSKKAVAVISPKSGSDISGTVTFIEQDGMVTMKAEVKG
LSEGNHAIHIHKIADCSSDDGKSAGGHWNPTEKNHGKWLQDPFHIGDIGNLVVDETGKGS
IERKTDLWAVGGENDLKNVVGHAIIIHQGPDDFSSQPSGAAGARIGCGEITRK
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatttaaaaaaaacatcattatttcttttaacaattataattttaagcgcttgt
agttcaaattcaaaaaaagcagttgcagttattagcccaaaaagtggtagcgatatttct
ggaactgtaacttttatagaacaagatggtatggttacaatgaaagcagaagttaaaggc
ctttctgaaggaaatcatgcaattcatattcataaaattgctgattgttcttcggatgat
ggaaaatctgctggcggacactggaatccgaccgaaaaaaatcatggaaaatggttacaa
gatccttttcatattggtgatattggaaatttagttgttgatgaaacaggcaaaggttct
attgaaagaaaaacagatttgtgggcagttggcggcgaaaatgatttaaaaaatgtggtt
ggtcatgcgattataattcatcaaggacccgatgattttagttctcaaccttctggcgca
gcaggtgcaagaattggttgtggagaaattactagaaagtaa

DBGET integrated database retrieval system