KEGG   Polaribacter sp. BM10: BXQ17_00905Help
Entry
BXQ17_00905       CDS       T04746                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
pola  Polaribacter sp. BM10
Brite
Translation factors [BR:pola03012]
 Eukaryotic Type
  Elongation factors
   BXQ17_00905
 Prokaryotic Type
   BXQ17_00905
Mitochondrial biogenesis [BR:pola03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BXQ17_00905
Exosome [BR:pola04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BXQ17_00905
  Exosomal proteins of breast cancer cells
   BXQ17_00905
  Exosomal proteins of colorectal cancer cells
   BXQ17_00905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
206531..207718
Genome map
AA seq 395 aa AA seqDB search
MAKGTFDRSKPHLNIGTIGHVDHGKTTLTAAITKVLADAGFSEARSFDQIDNAPEEKERG
ITINTSHVEYQTEKRHYAHVDCPGHADYVKNMVTGAAQMDGAILVVAATDGPMPQTREHI
LLGCQVGIPRIVVFLNKVDMVDDEELLELVDMEVRELLSFYEYDGDNGPVVSGSALGALN
GEQKWVDTVLELMKEVDAWIEEPLREVDKDFLMPVEDVFSITGRGTVATGRIETGIANTG
DVVDIIGMGAEKMTSTITGIEMFRQILDRGEAGDNAGILLRGIAKEDIKRGMVICKPGSV
TPHAKFKAEVYVLKKEEGGRHTPFHNNYRPQFYVRTTDVTGTINLPDGVEMVMPGDNLTI
TVDLIQPIALNVGLRFAIREGGRTVGAGQVTELLD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggaacttttgaccgttcgaaaccacacttaaacattggtactatcggacac
gtagatcacggtaaaacaactttaactgcggctattactaaagtattagctgatgcagga
ttctctgaggctagatcttttgatcagattgataatgctccggaagaaaaagaaagaggt
attacaattaacacttctcacgtagagtaccaaactgaaaagcgtcactatgcacacgta
gattgtccaggtcacgccgattatgttaagaacatggtaacgggtgctgctcaaatggat
ggtgctattttagttgttgctgcaacagatggaccaatgccacagactagagagcatatc
ttattaggttgtcaggtaggaattcctcgtatcgttgttttcttaaacaaagttgatatg
gttgatgatgaggagcttttagaattagttgatatggaagttagagaattattatctttc
tatgaatacgacggagataatggtcctgtagtttcaggttctgctttaggagctttaaat
ggtgagcaaaaatgggttgatactgttcttgaattgatgaaagaagttgatgcttggatt
gaggagccattaagagaggttgataaagatttcttaatgcctgttgaagatgtattctct
attacaggtcgtggtacagttgcaactggtcgtattgagactggtattgcaaatactgga
gatgttgtagatattatcggtatgggagctgaaaaaatgacttctactattactggtatt
gaaatgttccgtcaaatcttagatagaggagaggctggagataatgcaggtatcttatta
agaggtattgctaaagaagatattaaaagaggtatggtaatctgtaagccaggttctgta
acaccgcacgctaaatttaaagctgaagtttatgttttaaagaaagaagaaggtggtcgt
catactccattccataacaattaccgcccacaattctatgtaagaactacggatgttaca
ggtacaattaacttacctgatggtgttgaaatggtgatgccaggagataacttaacaatt
actgtagatttaattcagccaatcgcattaaatgttggtttacgtttcgctatccgtgaa
ggtggtagaactgtaggtgcaggtcaggtaactgaattattagattaa

DBGET integrated database retrieval system