KEGG   Polaribacter sp. MED152: MED152_04650Help
Entry
MED152_04650      CDS       T02533                                 

Gene name
sodC
Definition
(GenBank) copper/zinc superoxide dismutase (SODC)
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pom  Polaribacter sp. MED152
Brite
Enzymes [BR:pom01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MED152_04650 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu CHRD Big_3_5
Motif
Other DBs
NCBI-ProteinID: EAQ41978
UniProt: A2U0P1
LinkDB All DBs
Position
1022756..1023271
Genome map
AA seq 171 aa AA seqDB search
MKKISLLILLFAIAISCTKSEEKFAEATINAKSGSSVSGTVSFTQVDGKVMMKAELKGLT
PGTHAIHIHEKGDCSSDDGKSAGGHWNPTQDNHGKWKHGEFHSGDIGNLEADENGNATIE
KESDFWCIGCEDDTKNIIGHAIIVHAGTDDFKSQPSGAAGARVGCGEIMEK
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataagtctattaattttactttttgcaatcgcaatttcatgtacaaaaagt
gaagaaaaatttgctgaagcaactataaatgcaaaaagtggaagctcagttagcggaact
gttagttttactcaagttgatggtaaagttatgatgaaagccgaattaaaaggattaact
cctggtacacacgccattcatattcatgaaaaaggagattgttcttctgatgatggtaaa
tctgctggaggtcactggaacccaacacaagataatcatggaaaatggaagcatggcgaa
tttcatagtggagatattggtaatttagaagctgatgaaaatggaaatgctaccatagaa
aaagaaagtgatttctggtgcataggttgtgaagacgataccaaaaacattatagggcat
gccattattgttcatgcaggtacagatgattttaaatctcaaccttcaggtgctgctggt
gctagagttggttgtggagaaattatggaaaaataa

DBGET integrated database retrieval system