KEGG   Pongo abelii (Sumatran orangutan): 100174061Help
Entry
100174061         CDS       T01416                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04068  FoxO signaling pathway
pon04146  Peroxisome
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon05016  Huntington's disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100174061 (SOD2)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100174061 (SOD2)
 Organismal Systems
  Aging
   04211 Longevity regulating pathway - mammal
    100174061 (SOD2)
   04213 Longevity regulating pathway - multiple species
    100174061 (SOD2)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    100174061 (SOD2)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100174061 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 100174061
NCBI-ProteinID: NP_001127035
Ensembl: ENSPPYG00000017143
LinkDB All DBs
Position
6
AA seq 222 aa AA seqDB search
MLSRGVCGTSRQLAPALGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN
NLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEA
IKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttgagccggggagtgtgcggcaccagcaggcagctggcgccggctttgggatatctg
ggctccaggcagaagcacagcctccccgacctgccctacgactacggcgccctggagcct
cacataaacgcgcagatcatgcagctgcaccacagcaagcaccacgcggcctacgtgaac
aacctgaacgtcaccgaggagaagtaccaggaggcgttggccaagggagatgttacagcc
cagatagctcttcagcctgccctgaagttcaatggtggtggtcatatcaatcatagcatt
ttctggacaaacctcagccctaacggtggtggagaacccaaaggggagttgctggaagcc
atcaaacgtgactttggttcctttgacaagtttaaggagaagctgacggctgcatctgtt
ggtgtccaaggctcaggttggggttggcttggtttcaataaggaacggggacacttacaa
attgctgcttgtccgaatcaggatccactgcaaggaacgacaggccttattccactgctg
gggattgatgtgtgggagcacgcttactaccttcagtataaaaatgtcaggcctgattat
ctgaaagctatttggaatgtaatcaactgggagaatgtaacagaaagatacatggcttgc
aaaaagtaa

DBGET integrated database retrieval system