KEGG   Pongo abelii (Sumatran orangutan): 100431300Help
Entry
100431300         CDS       T01416                                 

Gene name
HDAC7
Definition
(RefSeq) histone deacetylase 7 isoform X1
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05034  Alcoholism
pon05165  Human papillomavirus infection
pon05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100431300 (HDAC7)
  Substance dependence
   05034 Alcoholism
    100431300 (HDAC7)
  Infectious diseases
   05165 Human papillomavirus infection
    100431300 (HDAC7)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100431300 (HDAC7)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100431300 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 100431300
NCBI-ProteinID: XP_024112951
Ensembl: ENSPPYG00000004446
LinkDB All DBs
Position
12
AA seq 991 aa AA seqDB search
MHSPGADGTQVSPGAHYCSPTGTGCPRPCADTPGPQLQPMDLRVGQRPPVEPPPEPTLLA
LQRPQRLHHHLFLAGLQQQRSVEPMRLSMDTPMPELQVGPQEQELRQLLHKDKSKRSAVA
SSVVKQKLAEVILKKQQAALERTVHPNSPGIPYRTLEPLETEGATRSMLSSFLPPVPSLP
SDPPEHFPLRKTVSEPNLKLRYKPKKSLERRKNPLLRKESAPPSLRRRPAETLGDSSPGS
SSTPASGCSSPNDSEHGPNPILGSEALLGQRLRLQETSVAPFALPTVSLLPAITLGLPAP
ARADGDRRTHPTLGPRGPILGSPHTPLFLPHGLEPEAGGTLPSRLQPILLLDPSGSHAPL
LTVPGLGPLPFHFAQSLMTTERLSGSGLHWPLSRTRSEPLPPSATAPPPPGPMQPRLEQL
KTHVQVIKRSAKPSEKPRLRQIPSAEDLETDGGGPGQVVDDGLEHRELGHGQPEARGPAP
LQQHPQVLLWEQQRLAGRLPRGSTGDTVLLPLAQGGHRPLSRAQSSPAAPASLSAPEPAS
QARVLSSSETPARTLPFTTGLIYDSVMLKHQCSCGDNSRHPEHAGRIQSIWSRLQERGLR
SQCECLRGRKASLEELQSVHSERHVLLYGTNPLSRLKLDNGKLAGLLAQRMFVMLPCGGV
GVDTDTIWNELHSSNAARWAAGSVTDLAFKVASRELKNGFAVVRPPGHHADHSTAMGFCF
FNSVAIACRQLQQQSKASKILIVDWDVHHGNGTQQTFYQDPSVLYISLHRHDDGNFFPGS
GAVDEVGAGSGEGFNVNVAWAGGLDPPMGDPEYLAAFRIVVMPIAREFSPDLVLVSAGFD
AAEGHPAPLGGYHVSAKCFGYMTQQLMNLAGGAVVLALEGGHDLTAICDASEACVAALLG
NKVDPLSEEGWKQKPNLNAIRSLEAVIRVHSKYWGCMQRLASCPDSWVPRVPGADKEEVE
AVTALASLSVGILAEDRPSEQLVEEEEPMNL
NT seq 2976 nt NT seq  +upstreamnt  +downstreamnt
atgcacagccccggcgctgatgggacccaggtgagcccgggtgcccactactgcagcccc
actggcacaggctgccccaggccctgtgcagacacaccaggccctcagctgcagcccatg
gacctgcgggtgggccagcggcccccagtggagcccccaccagagcccacattgctggcc
ctgcagcgtccccagcgcctgcaccaccacctcttcctagcaggcctgcagcagcagcgc
tcggtggagcccatgaggctctccatggacacgccgatgcctgagttgcaggtgggaccc
caggaacaagagctgcggcagcttctccacaaggacaagagcaagcgaagtgctgtagcc
agcagtgtggtcaaacagaagctggcagaggtgattctgaaaaagcagcaggcggcccta
gaaagaacagtccaccccaacagccccggcattccctacagaactctggagcccctggag
acggaaggagccacccgctccatgctcagcagctttttgcctcctgttcccagcctgccc
agtgaccctccagagcacttccctctgcgcaagacagtctctgagcccaacctgaagctg
cgctataagcccaagaagtccctggagcggaggaagaatccactgctccgaaaggagagt
gcgccccccagcctccggcggcggcccgcagagaccctcggagactcctccccaggtagt
agcagcacgcccgcgtcagggtgcagctcccccaatgacagcgagcacggccccaatccc
atcctgggctcggaggcgctcttgggccagcggctgcggctgcaggagacttctgtggcc
ccgttcgccttgccgacagtgtccttgctgcccgcaatcactctggggctgcccgcccct
gccagggctgacggtgaccgcaggacccatccgactctgggccctcgggggccaatcctg
gggagcccccacactcccctcttcctgccccatggcctggagcccgaggctgggggcacc
ttgccttctcgcctgcagcccattctcctcctggacccctcaggctctcatgccccgctg
ctgactgtgcccgggcttgggcccttgcccttccactttgcccagtccttaatgaccacc
gagcggctctctgggtcaggcctccactggccactgagccggactcgctcagagcccctg
ccccccagtgccaccgctcccccaccgccgggccccatgcagccccgcctggagcagctc
aaaactcacgtccaggtgatcaagaggtcagccaagccgagtgagaagccccggctgcgg
cagataccctcggctgaagacctggagacagatggcgggggaccgggccaggtggtagac
gatggcctggagcacagggagctgggccatgggcagcctgaggccagaggccccgctcct
ctccagcagcaccctcaggtgttgctctgggaacagcagcgactggctgggcggctcccc
cggggcagcaccggggacactgtgctgcttcctctggcccagggtgggcaccggcctctg
tcccgggcacagtcttccccagccgcacctgcctcactgtcagccccagagcctgccagc
caggcccgagtcctctccagctcagagacccctgccaggaccctgcccttcaccacaggg
ctgatctatgactcggtcatgctgaagcaccagtgctcctgcggtgacaacagcaggcac
ccggagcacgccggccgcatccagagcatctggtcccggctgcaggagcggggactccgg
agccagtgtgagtgtctccgaggccggaaggcctccctggaagagctgcagtcggtccac
tctgagcggcacgtgctcctctacggcaccaacccgctcagccgcctcaaactggacaac
gggaagctggcagggctcctggcacagcggatgtttgtgatgctgccctgtggtggggtt
ggggtggacactgacaccatctggaatgagctgcattcctccaatgcagcccgctgggcc
gctggcagtgtcactgacctcgccttcaaagtggcttctcgtgagctaaagaatggtttc
gctgtggtgcggcccccaggacaccatgcagatcattcaacagccatgggcttctgcttc
ttcaactcagtggccatcgcctgccggcagctgcagcagcagagcaaggccagcaagatc
ctcattgtagactgggacgtgcaccatggcaacggcacccagcaaaccttctaccaagac
cccagtgtgctctacatctccctgcatcgccatgacgacggcaacttcttcccggggagt
ggggctgtggatgaggtaggggctggcagcggtgagggcttcaatgtcaatgtggcctgg
gctggaggtctggacccccccatgggggatcctgagtacctggctgctttcaggattgtc
gtgatgcccatcgcccgagagttctctccagacctagtcctggtgtctgctggatttgat
gctgctgagggtcacccggccccactgggtggctaccatgtttctgccaaatgttttggg
tacatgacgcagcaactgatgaacctggcaggaggtgcagtggtgctggccttggagggt
ggccatgacctcacagccatctgtgacgcctctgaggcctgtgtggctgctcttctgggt
aacaaggtggatcccctttcagaagaaggctggaaacagaaacccaacctcaatgccatc
cgctctctggaggccgtaatccgggtgcacagtaaatactggggctgcatgcagcgcctg
gcctcctgtccagactcctgggtgcctagagtgccaggggctgacaaagaagaagtggag
gcagtgaccgcactggcatccctctctgtgggcatcctggctgaagataggccgtcggag
cagctggtggaggaggaagaacctatgaatctctaa

DBGET integrated database retrieval system