KEGG   Pongo abelii (Sumatran orangutan): 100444319Help
Entry
100444319         CDS       T01416                                 

Gene name
NEU2
Definition
(RefSeq) neuraminidase 2
  KO
K12357  
sialidase-2/3/4 [EC:3.2.1.18]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100444319 (NEU2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100444319 (NEU2)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     100444319 (NEU2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
2B
AA seq 388 aa AA seqDB search
MASLPVLQKESVFQSGAHAYRIPALLYLPGQQTLLAFGGTAGQSKKDEHAELIVLRRGGY
DAPTCQVQWQAQEVVAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRA
NVTRLAKVTSTDPREGPGSSPRDLTDAAIGPAYREWSTFAVGPGHCLQLHDRARSLVVPA
XSAYREPYHSIQRPSPSXLAFCFLSHDHGAPHGTQGHFVAQDTLECMVAEVEAGEQRVVT
LNARSHLRARVQAQSTNDGLDFQESQLVKKLAEPPPQGCQGSIISFPQPPLSGLAPQPKW
LLYTHPTHSWQRADLGAYLNPRPPAPEAWSEPVLLAKGSCAYSDLQSMGTGPDGSPLFGC
LYEANDYEEIVFLMFTLKQAFPAEYLPQ
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccctccctgtcctgcaaaaggagagcgtgttccagtcgggagcccatgcctac
agaatccctgccctgctctacctgcctgggcagcagaccctgctggccttcggcggaaca
gcggggcaaagcaagaaggatgagcacgcggagctgattgtcctgcgcagaggaggctac
gatgcacccacctgccaggttcagtggcaagctcaggaggtggtggcccaggcccggctg
gatggccatcggtccatgaacccatgccccttgtatgacgcgcagacggggaccctcttc
ctcttcttcattgccatccctgggcaagtcacggagcaacagcagctgcagaccagggcc
aatgtgacacggctggccaaagtcaccagcactgatccacgggagggacctggaagctcc
cccagagacctcactgatgcagccatcggcccagcctaccgggagtggtccacctttgcg
gtgggccccggtcattgtttgcagcttcatgacagggcccggagcctggtggtgcccgcc
taaagcgcctaccgggaaccttatcactccatccaaaggccgagcccctcctaacttgcc
ttctgcttcctcagccatgaccatggggcaccacatgggacgcaagggcactttgtggcc
caggacaccctggagtgcatggtggctgaagtcgaggctggggagcagagggtggtgacc
ctcaacgcgagaagccacctccgagccagggtccaggcccagagcaccaatgatgggctt
gatttccaggagtctcagctggtgaagaagctggcagagccgccgccccagggctgccag
gggagtatcatcagcttcccccagcccccgctcagtggcctggctccccagcccaagtgg
ctgctctacactcaccccacacactcctggcagagggccgacctgggcgcctacctcaac
ccgcgacctccagctcctgaggcctggtcggagccggtactgctggccaagggcagctgt
gcctactcagacctccagagcatgggcaccggccccgatgggtcccccttgtttgggtgt
ctgtacgaagccaatgattacgaggagattgtctttctcatgtttaccctgaagcaagcc
ttcccagctgagtacctgcctcagtga

DBGET integrated database retrieval system