KEGG   Pongo abelii (Sumatran orangutan): 100453690Help
Entry
100453690         CDS       T01416                                 

Definition
(RefSeq) pancreatic alpha-amylase-like
Organism
pon  Pongo abelii (Sumatran orangutan)
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase DUF3078
Motif
Other DBs
NCBI-GeneID: 100453690
NCBI-ProteinID: XP_024101911
LinkDB All DBs
Position
1
AA seq 511 aa AA seqDB search
MKFFLLLLTIGFCWAQYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPP
NENVAIYNPFRPWSERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGN
AVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNNATQVRDCRLVGL
LDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSKWFPEG
SKPFIYQEVIDLGGEPIKSSDYFGNGCVTEFKYGAKLSTVIRKWNGEKMSYLKNWGEGWG
FMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWP
RQFQNGKDVNDWVGPPNNNGVIKEVTINPDTICGNDWVCEHRWCQIRNMVIFRNVVDGQP
FTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGI
KIYVSDDGKAHFSISNSAEDPFIAIHAESKL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctttttgttgctcttaaccattgggttctgctgggctcagtattccccaaat
acacaacaaggacggacatctattgttcatctgtttgaatggcgatgggttgatattgct
cttgaatgtgagcgatatttagctcccaagggatttggcggggttcaggtctctccacca
aatgaaaatgttgcaatttacaaccctttcagaccttggtcggaaagataccaaccagtt
agctataaattatgcacaagatctggaaatgaagatgaatttagaaacatggtgactaga
tgtaacaatgttggggttcgtatttatgtggatgctgtaattaatcatatgtgtggtaat
gctgtgagtgcaggaacaagcagtacctgtggaagctacttcaaccctggaagtagggac
tttccagcagtcccatattcgggatgggattttaatgatggtaaatgtaaaactggaagt
ggagatatcgagaactacaataatgctactcaggtcagagattgtcgtctggttggtctt
cttgatcttgcactggagaaagattatgtgcgttccaagattgccgaatatatgaaccat
ctcattgacattggtgttgcagggttcagacttgatgcttccaagcacatgtggcctgga
gacataaaggcaattttggacaaactgcataatctaaacagtaaatggttccctgaagga
agtaaacctttcatttaccaggaggtaattgatctgggtggtgaaccaattaaaagcagt
gactactttggaaatggctgcgtgacagaattcaagtatggtgcaaaactcagcacagtt
attcgcaagtggaatggagagaagatgtcttacttaaagaactggggagaaggttggggt
ttcatgccttctgacagagcacttgtctttgtggataaccatgacaatcaacgaggacat
ggggctggaggagcctctatacttaccttctgggatgctaggctatataaaatggcagtt
ggatttatgcttgctcatccttatggatttacacgagtaatgtcaagctaccgttggcca
agacagtttcaaaatggaaaagatgttaatgattgggttgggccaccaaataataatggc
gtaattaaagaagttactattaatccagacactatttgtggcaatgactgggtctgtgaa
catcgatggtgccaaataaggaacatggttattttccgcaatgtagtggatggccagcct
tttacaaactggtatgataatgggagcaaccaagtagcctttggaagaggaaacagagga
ttcattgttttcaacaatgatgactggtcattttctttaactttgcaaactggtcttcct
gctggcacatactgtgatgtcatttctggagataaaattaatggcaattgcacaggcatt
aaaatctacgtttctgatgatggcaaagctcatttttctattagtaactctgctgaagat
ccatttattgcaattcatgctgaatctaaattataa

DBGET integrated database retrieval system