KEGG   Populus trichocarpa (black cottonwood): POPTR_0013s11870gHelp
Entry
POPTR_0013s11870g CDS       T01077                                 

Definition
(RefSeq) hypothetical protein
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pop00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    POPTR_0013s11870g
   00020 Citrate cycle (TCA cycle)
    POPTR_0013s11870g
   00620 Pyruvate metabolism
    POPTR_0013s11870g
Enzymes [BR:pop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     POPTR_0013s11870g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
LGXIII
AA seq 462 aa AA seqDB search
MALFLQTTFLTSSSSLRQKPCLSSWASHISSSRTRTRTRVHAKIREIFMPALSSTMTEGK
IVSWVKSEGDKLSKGESVVVVESDKADMDVETFYDGYLAAIMVEEGGVAAVGSAIALLAE
SPEEIEEAKSKAASSSPATSPAPAVAAAPAVVVTPPSPSVVASAVHPASEGGKRVVASPY
AKKLAKDLKVDLGRVIGSGPNGRIVAKDVEAAAAVAAELGSPAAKVSAAPAVQAPPGIEL
GSVVPFTTMQGAVCRNMVESLSVPTFRVGYTITTDALDALYKKVKSKGVTMTALLAKATA
LALVKHPVINSSCRDGNSFTYNSSINIAVAVAIDGGLITPVLQDADKVDIYSLSRKWKEL
VDKARAKQLQPQEYNTGTFTLSNLGMFGVDRFDAILPPGTGAIMAVGASQPTVVGTKDGR
IGMKNQMQVNVTADHRVIYGADLAAFLRTLAKIIEDPKDLTF
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggctctcttcctccaaaccacatttcttacttcctcctcttctcttcgccaaaaaccc
tgtctttcttcctgggcttcccacatttcctcttcaagaacccgcacccgcacccgcgtt
catgccaagatccgcgaaatcttcatgcctgctttgagttctactatgactgaaggcaag
attgtttcttgggtcaagtccgaaggtgataagctttctaaaggtgaaagtgttgttgtt
gttgaatccgacaaggctgacatggacgttgagactttctatgatggttacttggctgcc
atcatggtcgaggaaggtggtgttgctgccgttggatcggccattgctttgttagctgaa
tccccggaggaaattgaagaggctaagtctaaagctgcttcttcttctccggctacatct
ccagccccggcggtggcggcggctccggcagtcgtggtgacgccaccgtctccgtcggtg
gtggcatcggcggtgcatccggcgtcggagggagggaagagggtggtggcgtcgccatat
gccaagaagctcgcgaaggatttgaaggtggatttggggagagtgatagggagtgggcct
aatggcagaattgttgccaaggatgttgaggctgctgctgcagtggctgctgaattgggt
tccccagcagcgaaggtttcggcggcacctgctgtgcaggcaccgcccgggattgagttg
ggatcggtggtgccttttacgacgatgcaaggggcagtatgtaggaatatggtggagagt
ttgtcagtgcctacatttagagttgggtatactattactactgatgcacttgatgctctt
tacaagaaggtcaagtccaagggagtgacaatgacagcattacttgcaaaggcaactgca
ctggcattggttaagcatccagtaataaactctagttgccgagatggtaatagctttaca
tataatagtagcatcaacattgcagttgctgtggctattgatggtggcttgattacacct
gtgcttcaagatgctgataaggttgacatttactccctgtcaagaaaatggaaggagtta
gttgataaggcccgagccaagcaactgcaacctcaagaatacaacacgggcactttcacg
ctgtctaacctgggaatgtttggtgtggatcgatttgatgccattctgcctcctggaact
ggagcaattatggccgtcggagcatcacagccaactgttgtaggtaccaaagatggccgg
attggtatgaagaaccagatgcaggtaaatgttacagctgatcatcgtgtaatctatggt
gctgatctggctgccttcttgcgaacactggcaaagattattgaggaccccaaagacctt
accttctaa

DBGET integrated database retrieval system