KEGG   Paenibacillus sp. 32O-W: IJ21_46870Help
Entry
IJ21_46870        CDS       T04219                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pow  Paenibacillus sp. 32O-W
Brite
Enzymes [BR:pow01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     IJ21_46870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF2935
Motif
Other DBs
NCBI-ProteinID: ALS30049
UniProt: A0A0U2V8W4
LinkDB All DBs
Position
5189989..5191251
Genome map
AA seq 420 aa AA seqDB search
MLFVYGPYMPIRLLEEIRFWKTQEREHTAILRQLTPDLEPEYASLLEAWEPVFAETERRA
GLWIDEALPKAGQRSEQLAGQADVLLHASAYQSQSFVDQLLRIMNESAAVANNPQARSFI
LHAVRESTYYLGMMEAHEQVRRQTDAADGSPYDSGGDAETLEFGTADGPFRNGGAPEASG
AADASGAAQAEAGGEEPRSDAPPEEDGRSPVEQVPIGGHTLPPLPYPYHALEPHIDEQTM
RIHHDKHHQSYVDGLNKAEKELQKSRRTGNFDLVKHWERELAFNGAGHYLHTLFWNVMSP
HGGGRPSGALAEQLKRDFGSYDAFKKQFSEAAGKVEGGGWAILVWSPRSRRLEILTAEKH
QNLSQWDVVPILPLDVWEHAYYLKHQNKRDDYIKDWWNVVNWPYVSERFAEASRLQWKPY
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtgctttttgtatatggaccttacatgccgattcggctgctggaagaaattcggttctgg
aaaacgcaagaacgggagcataccgccatactcaggcaactgactcccgatctggagccg
gaatatgcgtcactgctggaagcgtgggaaccggtattcgcggagacggagcggcgggcg
ggcctgtggatcgacgaagcgctgccgaaggccggccagcggtcggagcagcttgccggt
caggcggacgtgctgctccatgcctccgcctatcagtcgcagtcgttcgtcgaccagctg
ctacgcataatgaacgagagcgccgcggtcgccaacaatccgcaggcccgttcctttatt
ctccatgccgtgcgcgaatcgacctattatctcggcatgatggaggctcacgagcaagta
cggcggcagacggacgcggcggacgggagcccgtatgacagcggcggcgatgcggagacg
cttgaattcgggacggcggacgggccgtttcgaaacggcggcgctccggaagcgagcggc
gctgcggatgcgagcggcgctgcgcaagccgaagccggcggggaagagccccgttccgac
gcgccgccggaggaggacggccggtcgccggtcgagcaggtgccgatcggcggacatacg
ttgccgccgctcccttatccctatcatgcgctcgagccccatatcgacgagcagacgatg
cgcattcatcacgacaagcatcatcaaagctacgtcgacggactaaacaaggcggagaaa
gagctgcagaagtcccgaaggaccggcaatttcgatctcgtcaagcattgggagcgggag
ctcgccttcaacggcgccggccattacctgcatacgctgttctggaacgtcatgtcgccg
cacggcggcggcaggccgagcggagcgcttgccgagcagttgaagcgggatttcggcagc
tacgatgcgttcaaaaagcagttcagcgaagccgccggcaaagtcgaaggcggcggctgg
gcgatactcgtctggagcccgcgcagccggcggctggaaattttgacggccgagaagcat
caaaacttgtcgcagtgggacgttgttccgatcctcccgctcgacgtgtgggagcacgcc
tattacttgaagcatcagaacaagcgcgacgattatatcaaggactggtggaacgtcgtc
aactggccttacgtaagcgaacgcttcgcagaagccagccggctccagtggaagccgtat
taa

DBGET integrated database retrieval system