KEGG   Komagataella phaffii: PAS_chr3_0732Help
Entry
PAS_chr3_0732     CDS       T01092                                 

Definition
(RefSeq) DNA ligase required for nonhomologous end-joining (NHEJ)
  KO
K10777  
DNA ligase 4 [EC:6.5.1.1]
Organism
ppa  Komagataella phaffii
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    PAS_chr3_0732
Enzymes [BR:ppa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PAS_chr3_0732
DNA repair and recombination proteins [BR:ppa03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     PAS_chr3_0732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3:complement(1394459..1397257)
Genome map
AA seq 932 aa AA seqDB search
MSEELKEPKNRAPLPNFSHLVYDLFEKLDTCVKSPHIPESLRSRKTKIIEQFVQKWRFEI
GDNIYPASRLIFPNLDKRHYNIKDFTLIKFILDIFQVPKDSEDTKILRNWKGKYENRMRS
NKNDLAQLLTGVIKARRGAVLDRPEISIDRLNELLDTMTRPETKPSDQKKILTEIFNHVD
NIELKWFLRILLKRKLMGGMDFTFFRQWHPDAVELLQLVNDLKTVFWELTDRLIPLPEAG
RVIRVGRAFRPQLAMRPNRTYDQIATLFDNNFYIEDKLDGERILIHISLNDTTQQHEFKY
FSRSGTDYTYLYGSNYEEGAFSPFIKGCFIDLKDDTKEIRSMVLDGEFLVYDNKRNVILP
FGALKSASLTRLMEEKNDSEDSQETQVYFVVYDLVFLNGTSFQDKALKVRRNLLNKILAN
PIPNRIEVIKYTEGHVGSDIEAAMRSAIHDNREGIVVKNPKSKYYIASRNLNWVKIKPEY
LEEFGENIDLIILGKRKGLKNAYICGLRESLGNDRYRFLSLARIANGFTGQMYEEIEHSL
GSKWVNIRKTQPPYPYIDLGEISSMVDYWVDPKESVVLEIKARSIDIGDGGKRYAAGTTL
YNAYCVRIRSDKDFLSCSTFADYKEIKTSKSRHKTEKTHSLMSKRKRTIVTEPILAKQSV
SSKSSIFKDYIFYVLSDMLGEKRYSIAQLEALLVENGGRITKNDCVALADGERLVLLSDK
ITFKVTEYFNKGLNVFRPGFILKCLQLKTIIPLQINDILLADESLIEKVKKNSDRFGDSY
TSPIDRKELRMLMKGIPKIKLEHPLKFPLLYNLFKGLKFYIARPCYRSPFLTNVMSPYLL
EVIVILGGFLTTDIFQCSFIIVDTSTTFNYSWLTEEATIQDEVGSLRKKLGDDLPIVKGV
LDKVPRIVEKEWVFKCIQEGTIVAADGYNYIG
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagagttgaaggagccaaaaaacagagcccctttacctaatttcagccatcta
gtttatgaccttttcgaaaaattggatacatgtgtcaaatcgcctcatattcctgaatct
ctcagaagtcgaaagaccaagataatagagcagtttgtccaaaaatggagatttgagata
ggtgataacatatatcctgcctcaagacttatttttcccaatttagataagcgtcactat
aatatcaaggattttacattgatcaagttcatattggacatcttccaagttccaaaagac
tccgaagatacgaagattttacgtaactggaaagggaagtatgagaatagaatgcgctcc
aacaaaaatgatctagctcaattactcactggagttattaaagctaggagaggtgctgtt
ttggatcggccagaaatttctattgacagactgaacgaacttttggatacaatgactcgc
cctgaaacaaaaccgtctgaccaaaaaaagattttgacggagattttcaatcatgtagat
aatattgaactgaaatggtttcttcggatcctactgaaaaggaagttaatgggtggtatg
gattttactttttttaggcagtggcatccagatgctgtagaattacttcaactggttaat
gacctgaaaactgtattctgggaactgactgatcggttgattccattgcctgaagcgggc
agagtcatcagagttgggcgtgcattcaggcctcaactggcaatgcgacccaatagaact
tacgatcaaatagctactctatttgacaataatttctacattgaagataaactagatggc
gaacggattttgatacacatcagcttgaatgacacaacccaacaacatgaattcaagtac
ttttcaaggagtggaactgactatacatatttatacgggtcaaactacgaagaaggtgca
ttctctcctttcatcaaaggttgcttcatagatctcaaagatgacacaaaagaaatccga
tctatggttttggatggggagtttctcgtttatgataacaaaagaaatgttattctcccc
tttggggctctcaagagtgccagtttaacgagattgatggaggagaaaaacgattcggaa
gactctcaagagacgcaagtgtatttcgttgtttatgatcttgtattcttaaatggtaca
tcatttcaagacaaagctctcaaggtaaggcggaatttactgaataaaattcttgcaaat
ccaatccctaacagaatagaagttatcaaatacacggagggtcatgtcggatcggatatc
gaagctgccatgagaagtgctatacacgacaatcgtgaaggaatcgtagtgaagaatcca
aaatcaaagtattatattgcatccagaaatctcaactgggtcaagataaaacctgagtac
ttggaagaatttggagaaaatatagatttgattattctaggcaaaagaaaaggactgaaa
aacgcctatatctgtggactcagagagagtcttggtaatgaccggtacagattcttgtca
ctggccagaattgccaatggatttacagggcaaatgtatgaagaaattgaacattcactg
gggagtaaatgggtcaatataaggaagacgcaaccaccttatccatacattgatctcgga
gagatatcatcgatggtggactattgggttgatcccaaagaatctgtcgttttagagatc
aaggctcgttcaattgatattggtgatggcgggaaacgttacgcagctggtaccactctt
tacaatgcgtattgtgtaagaattagatctgataaagacttcttatcatgttcgactttt
gcagattacaaagaaataaaaacttcaaagagtagacacaaaacagagaaaacacacagt
ctaatgagtaaacgaaagaggacaatagtcactgaaccaattctcgctaaacaaagtgta
tcttcgaagagcagcatattcaaggattacatcttttatgttttaagtgacatgttgggt
gaaaaacgatactctattgctcagctggaggctttgctggtcgagaatggtggcagaata
actaagaatgattgcgtagctcttgcagatggcgagaggcttgttttacttagtgacaag
attactttcaaagtcacagagtactttaataaaggtctaaatgtctttcgaccaggcttc
attctgaagtgtcttcagctgaaaactataattcctctacaaattaacgacatattactg
gcggatgagtctttgatagaaaaggtaaagaaaaactccgaccgatttggggatagttat
acctctcccattgaccgtaaggagttgcgaatgcttatgaaaggtatacctaagataaag
ttagaacacccactaaaatttccactactgtacaacttgttcaagggcctgaagttttat
atcgcaagaccatgctatagatctccatttctgacaaatgttatgagtccatacttgtta
gaagtaatagtgattctaggaggatttcttacaactgatattttccaatgttcatttata
atcgtggatacttccaccacattcaactattcctggttgactgaggaggcgaccatacag
gatgaagttgggtctctaagaaaaaagctgggtgatgatctaccaatcgtcaaaggtgtt
ctagataaagtaccccggatagtagagaaagagtgggtgttcaaatgtatccaggaaggg
acaatcgttgctgcggatggctataactatatcggttaa

DBGET integrated database retrieval system