KEGG   Pectobacterium parmentieri RNS08.42.1A: A8F97_15530Help
Entry
A8F97_15530       CDS       T04513                                 

Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
ppar  Pectobacterium parmentieri RNS08.42.1A
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppar00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    A8F97_15530
Enzymes [BR:ppar01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     A8F97_15530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(3425827..3426759)
Genome map
AA seq 310 aa AA seqDB search
MSIILPHHAPTDSYKGCTPGSRRSALRELLQQQKGIRVMEAHSPLSALLIEQAAYEDGDI
HYQFDAFWSSSLTDSTLRGKPDTELVDISHRFQAITEIFDVTTRPLIFDGDTGGQTEHLS
HRIRAAENLGISAMIIEDKTGLKKNSLFGNDVKQTQASVADFCEKITTAKKAQLTPEFML
IARIESLILDVGMEDAINRALHYADAGADGIMIHSRHKNPSEILAFAKQFRDHYPHLPLV
CVPTSFNDITFDQLIDGGFNIVIYANHMLRAAYPAMKSILPEILKHGRTLEVEDQCMSIK
DILDLIPGTR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcattttacctcatcatgccccaacggattcatataaggggtgtacgccaggc
tcacgtcgtagtgcactccgtgaattattgcagcagcaaaaaggcattcgtgtgatggag
gctcacagtccgctttctgctttattaatcgagcaagctgcttatgaagatggcgatatt
cattatcaatttgatgcgttttggtctagctcactcaccgattccactttgcgtggaaaa
cccgatacggagttagtagacatcagtcatcgttttcaagcgattacggaaatatttgat
gttactacccgcccattaatttttgacggtgatactggcgggcaaactgaacatttatcc
caccggatccgtgccgccgaaaatctgggtatttccgccatgattatcgaagataaaacc
ggcctgaaaaagaactctttatttggtaatgatgtaaagcaaacgcaggcttctgtagcg
gatttttgcgaaaaaattacgactgcaaaaaaagcacaactgacgcccgagtttatgtta
atcgcgcgtattgagagcctgattctggacgtcggtatggaagatgcgataaaccgtgcc
ttacattatgctgatgccggtgccgatggcattatgatccacagtcggcataagaaccct
tctgagattttagctttcgctaaacaattccgcgatcattatccacatttacctttggtt
tgtgttcctaccagttttaacgatattactttcgatcaactgattgatggtggattcaat
attgttatttacgcaaaccatatgttacgtgcggcttatcctgcgatgaaatcaatttta
ccagaaatcctcaagcatggtcgaacgctggaagttgaggatcaatgcatgtcgataaaa
gatattctggatcttatacccggcacgcgatag

DBGET integrated database retrieval system