KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_1613Help
Entry
PPUBIRD1_1613     CDS       T01975                                 

Definition
(GenBank) Antibiotic peptide synthase
Organism
ppb  Pseudomonas putida BIRD-1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1795592..1808545
Genome map
AA seq 4317 aa AA seqDB search
MTDAFELPLSLVQALAQRAAQTPDRIALRFLADTPGEQAVLSYRDLDQRARTIAAALQAR
ASFGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESARQQHQERLLSIIDDAEPRLL
LTVAALHDSLQGLEALAADNVPQLLAVDGLDPALAANWREPVLKGDDIAFLQYTSGSTAL
PKGVQVSHGNLVANEQLIRQGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVL
MSPGYFLARPLRWLQAISEYGGTISGGPDFAYRLCSERVSEASLAGLDLSRWRVAYSGSE
PIRQDSLATFADKFQACGFDPQSFFASYGLAEATLFVSGSRRGQGIAALELDAKAFAANR
AEPGTGSVLMSCGFPQPGHAVRIVEPQQLQVLGDNQVGEIWAGGPSIARGYWRNPEASAR
TFVEMDGQTWLRTGDLGFMRDGEVFVTGRLKDMLIVRGQNLYPQDLEKTLEREVQVLRKG
RVAVFAVEHQGEEGIGVAVEISRNVRKALKPQDLIKTLRQVVADTCRQAPAVVLLLNPGA
LPKTSSGKLQRSACRLRMDDGSLDCYARFPEVSEAGTRASAGDELQARIAAVWRDILKVE
AVAADDHFLLLGGNSIAATQATARLADELGIDLSLRTLFEAPVLADYSKAVAQIIADGAA
GTAAITTLERAQALPQSLAQNRLWLLWQLEPQSAAYNIPAGLHLRGELDVNALQVSFQAL
VARHESLRTVFSEENGQALQRILPQQPFSLHRLDLEGHSPEQVAALRETEARQPFDLTQG
PLLRVTLVRLGDEEHQLWVTLHHIVADGWSLNILLEEFAKLYAARCQGLEANLAPLPLGY
ADYGSWQRQWLADGEAERQLQYWKAHLGGELPALDLCTDHPRASQREHSAARFNLKVPAR
LGEALKSLAHQQQASLFMVLLAGWQALLQRYSGQADIRVGVPNANRPRLETQGMVGFFIN
TQALRAQFDGRHSFTQLLTQVRQATLQAQANQDLPFEQLVEALPDAREQGLFQVMFNHQQ
RDLSALRRLPGLLAEELAWHSREAKFDLQLHSEEDHLGRLSLAFDYAAELFEASTVERLA
HHLLALLEQVCAAPQQALGDVQLLDEPGRAQLLGWGQAPAAAAQHLLVEQLNEQARLTPQ
RTALVWDGGSLDYAGLHQQANRLAHYLRDKGVGPDTCVAIAIERSPQLLVGLLAILKAGG
AYVPLDVDYPAERLAYMLADCDARLLLSHSSLLGKLPQVDGVSAIALDQLHLDSWPSHAP
GLHLHGDNLAYVIYTSGSTGQPKGVGNTHAALAERLQWMQTTYALNDSDVLMQKAPISFD
VSVWECFWPLVTGCKLVLAGPGEHRDPQRIAALVQAYGVTTLHFVPPLLQVFVQEPQAGA
CSSLRRVFSGGEALSATLRDRVLQVLPQVQLHNRYGPTETAINVTHWHCQMADGERSPIG
RPLGNVLCRVLDDELELSAPGVPGELYLGGAGLARGYLGRPGLTAERFVPQADGNGQRLY
RSGDRARWQVQLEALEYLGRLDQQVKVRGFRVEPEEVQACLLAQAGVEQALVLIHKDAVG
AQLVGYYSGSAQPAEVLAVLAEQLPAYMVPAQLIPLAQMPLGPSGKVDRKALPAPVWQQR
EHVEPRTELQQQVAGIWRDVLNLPRIGLQDDFFALGGHSLLATQIVSRTRQACDVELPLK
ALFEASELGAFCAEIARLRAAGERNLQGAITRVDRRQAVPLSYSQQRMWFLWQMEPDSPA
YNVGGMARLRGTLHVDAFERALQALIVRHETLRTTFPSIDGVPYQCVAEDSGLHLDWQDF
SALSDDACQQRLQQLADDQAHQPFDLERGPLLRACLVKANEREHFFVLTLHHIVTEGWAM
DIFARELGELYEAFVDDRESPLAPLPVQYLDYSVWQRQWLESGEGARQLAYWKHRLGDEH
PVLALPADRPRPAVQSHRGELYRFELDPALVARVHAFNSQRGLTLFMTMTATLAALLHRY
SGQRDLRIGAPVANRIRPESEGLIGAFLNTQVLRCELDGQMTASALLEQVRQAAIEGQSH
QDLPFDQLVEALQPPRSSAYNPLFQVMCNVQRWAFQQSRTLAGMQVDYLVNDASATKFDL
YLEVTDLDGRLGCCLTYSRDLFDAPRIARMAEHWQQLLVGLLDNPQHRLCELPMLSSAER
QVLTGQLQGEHDFDLGQTLHGLFAAQAARTPQAGALTFAGQHLTYAELDQQANRLARALR
ERGVGPQVRVGLALERSLEMVVGLLAILKAGGAYVPLDPEYPLDRLRYMIEDSRIGLLLS
QRALLHTLGELPEGVASWSLEDDAASLAAYSDAPLDNLSLPQHQAYLIYTSGSTGKPKGV
VVSHGEFAMHCQAVIAAFGMRSDDCELHFYSINFDAASERLWVPLLCGARVVLRAQGQWG
AEDICQLVREQQVSILGFTPSYGSQLAQYLGGRGEQLPVRLVITGGEALTGEHLQRIRQA
FAPQQCFNAYGPTETVVMPLACLAPDALPADLGSVPIGRVIGSRTAYILDEDLALLPQGG
IGELYVGGAGLAQGYHDRPGLTAERFVADPFSAEGGRLYRTGDLVRLGTDGLVEYVGRAD
QQVKIRGFRIELGEIESRLQAHHDVDEAVVLALDLPGGKQLVGYLVCRQATASSDAQQLL
REAVKADARQHLPDYMVPAHLVLLDSLPLMGNGKLDRRALPLPDLEQARQQYQPPGNEVE
AQLAQIWREVLNVARVGVQDNFFELGGDSILSIQVVSRARQAGLQFTPRDLFQHQTIQTL
AAVVQLSEAVSTVEQGLRQGQAGLTPIQHWFFDSDVPQPQHWNQAVLLEVRHPLVEATLE
QALAALVQHHDSLRLRFSDAQGRWQAQYAQPGAEQLLWSATVADFNDCQALYTDVQRSLD
LQQGPLLRALLVRDGQCTQRLLLAIHHLVVDGVSWRVLLEDLQALYRGQPLPAKTHAVGD
WAARLASYAGSDSLRDELAWWQGQLGGVRRELPCDHPQGGNLHRHAQTLAIGLDVEQTRQ
LLQLAPAAYHTQVNDLLLTALARALCRWSGDEEVLVQLEGHGRDGLFEDMDLTRSVGWFT
NAYPLSLRPLPGEDDAARAGSIKRIKEQLRQVPHKGLGYGVLRYLADAAGREQMAALPQA
RITFNYLGQFDQQFDSAALFQPLEAPAGLAHDLDAPLPNWLSVDGQVYGGALQLRWTFSA
ERYDQQTIAGLAEAYRQELLALVAHCLADGNGSFTPSDFPLAHLTQEQIDALPVPAAQIE
DVYPLTPMQEGMLLHTLLEPGTGLYYMQDRYRINSALDPERFAQAWQAVVARHEALRASF
SWNSGEAMLQIIHKPGNLAVDYQDWRGLAEDAQEQRLQALHKQEREAGFALLSEAPFHLR
LVRVADERYWFMMSNHHILIDAWCRSLLMNDFFEVYQALGEGRQAQLPVPPRYRDYIGWL
QRQGLDDARAWWQANLAGFERATAIPSDRPLRHDHAGSGMVVGDCYTRLEVSDGVRLREL
AQAHQLTVNTFAQAAWALVLARYSGDRDVAFGVTVAGRPVSMPQMQRTVGLFINSVALRV
QLPIAGERCSVRQWLQGLLQSNTELREYEYLPLVAIQACSELPKGQPLFDSLFVFENAPV
ETAVLDHAQHLNASSDSGRTHTNFPLTAVCYPGDDLGLHLSFDQRYFDYPTVERLLAEFK
RLLLALVQGFEGEVSELPLLSAQEQGFLLEDCNRTERVYPLEQSYIAQFEAQVVAHPQRT
VARCLEASYDYAGLNLAANRLGHALVAAGVCVDQPVALLAERGLPLLGMIVGSFKAGAGY
LPLDPGLPAARLQSIIQLSRTPVLVCSAACAEQGRQLLGELEAALRPQLLVWEDVQANPI
ASHNPGIHSGPDNLAYVIYTSGSTGLPKGVMVEQSGMLNNQLSKVPYLALSEQDVIAQTA
SQSFDISVWQFLAAPLFGAKVEIVPNAIAHDPQGLLAHVQATGITVLESVPSLIQGMLAS
DHQALDGLRWMLPTGEAMPPELAAQWLQRYPQIGLVNAYGPAECSDDVAFFRVDAASTQG
SYLPIGTPTDNNRLYLFGEDQALVPLGAVGELCVAGTGVGRGYVGDPVRTALAFIPHPYG
APGERLYRTGDLARQRPDGVLEYVGRIDHQVKIRGYRIELGEIEARLHEQAEIRDAAVAV
QEGVNGKHLVGYLVAHQGVSADAALLEQVKQRLRAELPEYMVPLHWGWFDSLPHNANGKL
DRKALPAIDIGGQYSQAYQAPRNELEDVLAGIWADVLKAERVGVHDNFFELGGHSLLATQ
IASRVQKQLQLNVPLRAMFECSTVEALAEYVQGLQGSALDDDKVDRLSDLMAELEGL
NT seq 12954 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgccttcgaactcccgctctcgctggtccaggccctggcgcaacgcgccgcg
cagaccccggacaggattgccctgcgctttctcgccgacacgcccggtgagcaggccgtg
ctcagctaccgggacctcgaccagcgtgcacgcaccatcgccgccgccttgcaggcgcgc
gccagcttcggtgaccgtgccgtgctgttgttccccagcgggccagattacgtggcggcg
ttcttcggctgcctgtatgcgggcgtgatcgcggtgccggcctacccgccggagtccgcg
cgccagcagcaccaggagcgtttgctgtcgatcatcgatgacgccgagccgcgcctgctg
ctgaccgtggcggcgctgcacgacagcctgcagggcctggaagccctggcggcggacaat
gtcccccaactgctggcagtggatggcttggacccggccctggctgcgaactggcgtgaa
cccgtgctcaagggcgatgacatcgccttcctgcagtacacctccggctccaccgcgctg
cccaagggcgtgcaggtcagccatggcaacctggtggccaacgagcaactgatccgccaa
ggctttggcatcgacctcaaccccgacgatgtgatcgtcagctggctaccgctgtaccat
gacatgggcctgatcggcggcctgctgcagccgatcttcagtggcgtgccttgcgtgctg
atgtcgccggggtacttcctggcccggccgttgcgctggttgcaggccatcagcgaatac
ggtggcaccatcagcggcgggcccgacttcgcttatcgcctgtgcagcgagcgggtcagc
gaggcttcgctggccgggctcgacctgagccgctggcgcgtggcctattccggctccgag
ccgatccgccaggacagcctggccaccttcgccgacaagttccaggcctgtggcttcgac
ccgcagagcttcttcgccagttatggcctggccgaagccaccctgttcgttagcggcagc
cgtcgtggccagggtatcgccgcgcttgagctggatgccaaagccttcgccgccaaccgc
gccgaacccggcactggcagcgtgctgatgagttgcggcttcccgcagccggggcacgcg
gtacgcatcgtcgagccgcaacagttgcaagtgctgggcgacaaccaggtgggggaaatc
tgggcaggcggcccgagcatcgcccggggctactggcgcaacccagaagccagcgctcga
accttcgtcgaaatggacggccagacctggctgcgtaccggcgacctgggcttcatgcgt
gacggcgaggtattcgtcaccgggcgtctgaaggacatgctgatcgtgcgtgggcaaaac
ctgtacccacaagacctggagaaaaccctcgagcgcgaagttcaggtgctgcgcaaaggc
cgggtggcggtgttcgccgtcgagcaccaaggcgaggagggcatcggtgtcgcggtggag
atcagccgcaacgtgcgaaaggcactcaagccccaggacctgatcaagaccctgcgccag
gtcgtcgccgacacctgccgacaggccccggccgtggtcctgctgctgaaccccggcgcg
ctgccgaagacctccagcggcaagttgcagcgctctgcctgccggctgcgcatggacgat
ggcagcctggactgctatgcccgtttccctgaggtgagcgaagccggtacccgtgcatcc
gctggcgacgagctgcaagcacgcatcgccgctgtgtggcgcgacatcctcaaggtagag
gcggtggccgcggacgaccacttcctgctgctgggcggtaactccatcgccgccacccag
gccacagcgcgcctggccgatgagttgggtatcgacctgagcctgcgtaccctgttcgag
gcgccggtactggccgactacagcaaggccgtggcacagatcatcgccgatggcgccgct
ggcaccgcagccatcaccacgctggagcgcgcccaggcgttgccccagtcgctggcgcaa
aaccgcttgtggctgctgtggcagctggaaccgcaatcagcggcctacaacattcccgcc
ggcttgcacctgcgtggcgagctggatgtcaatgctctgcaagtgagcttccaggcactg
gtggcgcgccatgaatcgctgcgtactgtgttcagcgaagagaatggccaggcgctgcag
cgtatcctgcctcaacagccgttcagcctgcaccgcctggaccttgaagggcactcgccc
gagcaggtcgccgcgctgcgggaaaccgaggcccgccagccgttcgacctcacccagggc
ccgctgctgcgggtaaccctggtgcgcctgggcgacgaagagcatcagctgtgggtgacc
ctgcaccacatcgttgccgacggctggtcgctgaacatcctgctcgaagaattcgccaag
ctgtatgccgctcgctgccaaggcctggaggccaacctggcgccgctgcccctggggtac
gccgactacggcagctggcagcggcaatggctggctgacggtgaagccgaacgccagttg
cagtactggaaggcacaccttggtggtgagctgccggcgctcgacctgtgcactgaccac
ccgcgcgccagccagcgcgagcacagcgctgcgcgcttcaacctcaaggtgccggccagg
cttggcgaagcgctcaagagccttgcccaccagcagcaggccagcctgttcatggtcctg
ctggcaggttggcaggcgctgctgcagcgctacagcggccaggccgatatccgcgtcggc
gtgcccaacgccaaccgcccgcgcctggaaacccaaggcatggtcggtttcttcatcaat
acgcaggcgctgcgcgcgcaattcgatggccgtcactcgtttacccagttgctgacccag
gtacgacaggccacgttgcaagcccaggctaatcaggacctgcccttcgaacagcttgtc
gaagccctgcccgatgcgcgcgaacagggcctgttccaggtcatgttcaaccaccagcaa
cgcgacctgtcagccctgcggcgtctgccggggctgttggccgaagagctggcgtggcac
agccgcgaagccaagttcgacttgcagttgcacagtgaggaggaccatctgggtcgcctg
agcctggccttcgactacgccgcggagctgttcgaagccagcaccgtcgaacgtctggcc
catcacctgctggcgctgctggaacaggtgtgtgccgcgccgcagcaggcgctgggcgac
gtgcaattgctggatgagcccggccgtgctcagctgctgggttggggccaggcaccggcc
gccgcagcgcagcacctgttggtcgaacaactcaatgagcaggcacgcctgacgccgcag
cgcaccgccctggtttgggacgggggcagcctggattacgccgggctgcaccagcaagcc
aaccgcctggcccactacctgcgtgacaaaggcgtcggccccgatacctgtgtggccatt
gccatcgagcgctcaccgcaattgctggtcggcctgctagccattctcaaggccggcggt
gcctacgtgccgctggatgtcgattaccctgccgaacgcctggcctacatgctggccgac
tgcgacgcccgtttgctactgagccacagcagcctgctgggcaagctgccgcaggtcgac
ggtgtcagcgccattgccctcgaccagttgcacctggacagctggcccagccatgccccc
ggcctgcacctgcacggcgacaacctggcctacgttatctatacctccggctccaccggg
cagcccaagggcgtaggcaatacccatgcggcgttggccgagcgcctgcagtggatgcag
acgacctatgcgctgaatgacagcgacgtgctgatgcagaaggcgccgatcagtttcgac
gtctcggtgtgggaatgcttctggccgctggtcaccggctgcaagctggtgctcgccggc
cctggtgaacaccgcgacccgcagcgtatcgctgccctggtgcaggcttatggggtgact
acgctgcactttgtaccgccgctgttgcaggtgttcgtccaggagccgcaggcaggtgcc
tgcagcagcttgcgccgggtgttctcgggtggcgaagcgttgtccgccacgctgcgtgac
cgcgtgctgcaggtgctgccgcaggtgcagctgcacaaccggtacggcccgaccgaaacc
gccatcaacgtcacccactggcactgccagatggcggacggcgagcgctcgcccatcggc
cgcccgctgggcaatgtgctgtgccgcgtgctggacgatgagctggagctgagcgccccc
ggtgtgccgggtgaactgtacctcggtggcgcgggcctggcccgtggttacctgggccgc
cccggcctcactgccgagcgcttcgtaccccaggccgacggcaatggtcagcgtctttac
cgcagtggcgatcgcgcccgctggcaggttcagctggaggccctggaataccttggccgc
ctcgaccagcaggtcaaggtgcgtggtttccgcgtcgagcccgaggaagtgcaggcctgc
ctgctggcacaggcgggtgtggaacaggcgctggtgttgatacacaaggacgccgttggc
gcgcaactggtcggctattacagtggcagcgcccagcctgccgaggtgctggccgtgctg
gctgagcaattgccagcctacatggtgccggcgcaactcatccccttggcacagatgcca
ctgggccccagcggcaaggtcgaccgcaaggcactgcctgccccagtgtggcagcagcgt
gagcatgtcgagccacgaaccgagctgcaacaacaggtcgcgggcatctggcgcgacgtg
ttgaatctgccgcgcattggcctgcaggacgacttctttgcccttggtggccactcgttg
ctggctacccagatcgtttcgcgcacccgccaggcctgcgatgtcgagctgccgctcaag
gccctgttcgaagccagcgagctgggcgccttctgtgccgagatcgcccgcctacgcgcg
gccggcgagcgcaacctgcaaggtgcaatcacccgtgtcgaccgccgtcaggcggtgcca
ttgtcgtactcgcagcagcgaatgtggttcctctggcagatggaaccggacagcccggcg
tacaacgtcggcggcatggcacgcctgcgcggcaccctgcacgtggacgccttcgagcgt
gcactgcaggcgctgatcgtgcgtcacgaaaccttgcgcaccacgttccccagcatcgac
ggcgtgccgtaccagtgcgtagccgaagacagcggcctgcatctggactggcaagacttc
agcgctttgtcagacgatgcctgccagcaacgtttgcaacaactggccgacgaccaggcg
caccagcccttcgacctggagcgggggccgctgctgcgcgcgtgcctggtcaaggccaac
gagcgcgagcacttctttgtgctgacgctgcaccacattgtcaccgaaggctgggccatg
gacatcttcgcccgcgagctgggcgagctgtacgaagcctttgtcgatgaccgcgagtcg
ccactggcgccgctgccggtgcagtacctggactatagcgtgtggcagcggcaatggctg
gaaagcggcgagggcgctcgtcaactggcctactggaagcaccgcctgggcgacgagcac
ccggtgctggcgttgcctgccgaccgcccgcgtccggcagtccagagccaccgtggcgag
ctgtaccgcttcgaactcgatccggcactggtggcccgcgtgcatgctttcaatagccag
cgcggcctgaccctgttcatgaccatgaccgccaccctggccgccttgctgcaccgctac
agcggccagcgcgacctgcgtatcggcgcgccggtggccaaccgcatccgcccggaaagc
gaaggcctgatcggcgctttcctcaacacccaggtgctgcgctgcgagctggacggccag
atgaccgccagcgcgctgctggagcaggttcgccaggctgccatcgaaggccagtcgcac
caggacctgccgttcgaccaactggtagaggccctgcagcccccacgcagcagtgcctac
aacccgctgttccaggtgatgtgcaacgtgcagcgctgggcattccagcaaagccgtacg
ctggccggcatgcaggtggattacctggtcaacgatgccagcgccaccaagttcgacctt
tacctggaggtgaccgacctggacggccggctgggctgctgcctgacctacagccgcgac
ctgttcgacgcgccgcgtatcgcgcgcatggccgagcactggcaacaactgctggtcggt
ttgctcgacaacccgcaacaccgcctgtgcgaactgccaatgctgagcagtgccgagcga
caagtgcttacaggccagttgcagggcgaacacgatttcgaccttggccagaccctccac
ggtctgttcgccgcccaggccgcgcgcacgccacaggctggcgcgttgaccttcgccggc
cagcacttgacctacgccgagctcgaccagcaggccaaccgtctggcgcgtgccctgcgc
gaacggggtgtcggcccgcaggtgcgcgtgggcctggcgctggagcgctcgctggaaatg
gtcgtcggcctgctggccatcctcaaggccggcggcgcctatgtaccgctcgaccccgag
tacccgctcgaccgcctgcgctacatgatcgaagacagccgcatcggcttgctgctcagc
cagcgtgcgctgctgcacaccctgggcgagctgcctgaaggcgtggccagctggagcctg
gaagacgatgccgccagcctggcagcctacagcgatgcgccgctggacaacctcagcctg
ccgcagcaccaggcttacctgatctacacctcaggctccaccgggaaacccaagggcgtg
gtggtcagccatggcgagttcgccatgcactgccaggcggtgatcgctgcattcggcatg
cgcagcgatgactgcgagctgcatttctattcgatcaacttcgacgctgccagcgagcga
ctgtgggtgccgctgttgtgtggtgcgcgtgtggtgctgcgcgcccaggggcagtggggc
gccgaggacatctgccagttggtgcgcgagcagcaggtaagcattctgggctttaccccc
agctacggcagccagctggcgcagtacctgggcgggcggggcgaacaattgccggtacgc
ctggtgattaccgggggcgaagcgctgaccggcgagcacctgcaacgcatccgccaggcc
tttgcaccgcagcagtgcttcaatgcctacggcccgaccgaaaccgtggtcatgccgctg
gcgtgcctggcgccagacgcgttgccagcagaccttggcagcgtaccgatcggccgcgtc
atcggtagccgtacggcctatatcctcgacgaggatctggccttgttgccgcaaggcggc
attggcgaactgtatgtcggcggcgccggcctggcccagggttaccacgaccggccaggc
ctcactgccgagcgctttgtcgccgacccgttcagtgccgaaggcgggcgcctgtaccgt
accggagacctggtacgcctgggtaccgatggcctggtggagtatgtcggccgtgccgac
cagcaggtgaagatccgcggcttccgcatcgaactgggcgaaatcgagagccgcttgcag
gcgcaccacgatgtcgacgaggccgttgtgctggcgctggacttgccgggcggcaagcag
ctggtgggctatctggtgtgcaggcaggccaccgccagtagcgacgcgcaacaactgctg
cgcgaagcggtgaaagccgatgcccgccagcacctgcccgactacatggtgcctgcgcac
ctggtgctgctcgacagcctgccgctgatgggcaacggcaagctcgaccgccgcgcgctg
ccattgccggaccttgagcaggcgcggcagcaataccagccccctggcaatgaggtggaa
gcacagctagcgcagatctggcgcgaggtgctcaacgttgcccgggtcggcgtgcaggac
aacttcttcgagctggggggcgactcgatcctgtcgattcaggtggtcagccgcgcccgg
caggccggcttgcaattcaccccgcgcgacctgttccagcatcagaccatccagaccctg
gcagctgtggttcagctcagcgaagccgtgagcacggtggagcagggactgcgccagggc
caggccgggttgacgccgatccagcactggttcttcgacagtgacgtgccacagccgcaa
cactggaaccaggccgtgctgctggaggtgcgccaccccttggttgaggccacccttgaa
caggcgttggctgcgctggtgcagcaccatgacagcctgcgtctgcgcttcagcgacgcc
cagggccgctggcaggcgcagtacgcgcagcctggcgccgagcaactgctgtggagcgcc
actgtcgccgatttcaatgattgccaggcactctacactgacgtgcagcgcagcctggac
ctgcaacaggggccgctgctgcgcgccttgctggtgcgtgacgggcagtgcacccagcgg
ttgttgctggcgatccatcacctggtggtcgatggtgtgtcctggcgggtgctgctggaa
gacctgcaggcgctgtaccgtggccagcctctgccggccaagacccacgccgtcggcgac
tgggccgcgcgcctggccagctacgccggcagcgattcgctacgtgacgaactggcttgg
tggcaaggccagctgggcggtgtgcgtcgcgaattgccgtgcgaccatccgcagggcggc
aatttgcatcgccatgctcaaaccctggccatcggcctggacgtggagcaaacccgacag
ctgttgcaactggccccggcggcttaccacacccaggtcaacgacctgctgttgactgca
ctggcgcgggccttgtgccgctggagcggcgatgaagaagtgctggtgcagcttgaaggc
catggccgtgatgggctgttcgaagacatggacctgacccgcagcgtcggctggttcacc
aatgcctacccactgagcctgcgtccgctgccaggtgaagacgacgcggcgcgggccggt
tcgatcaagcgcatcaaggaacaactgcgccaggtgccgcacaagggcctgggctacggc
gtactgcgctacctggcggatgccgccgggcgcgagcagatggcggccttgccgcaggcg
cgcatcaccttcaactacctgggccagttcgaccagcagttcgacagtgcggccttgttc
cagcccctggaggccccggccgggttggcccatgacctcgatgcgccgttgcccaactgg
ttgagcgtcgatggccaggtgtatggcggtgctctgcaactgcgctggaccttcagcgcc
gagcgctacgatcagcagaccatcgcgggtctggccgaggcctatcgtcaggagctgctg
gcgctggtcgcgcattgcctggccgatggcaatggcagcttcaccccatcggacttcccg
ctggcgcacctgactcaggagcagatcgacgcattgccggtaccggccgcgcagatcgag
gacgtttacccgctgacgccgatgcaggaaggcatgctgctgcacaccctgctggagccg
ggcactggcctgtactacatgcaggaccgctaccgcatcaacagcgccctcgaccccgag
cgtttcgcccaggcctggcaggccgtggtggcgcgccacgaagcgttgcgcgcctcgttc
agttggaacagcggcgaggcgatgctgcagatcatccacaagccgggcaacctggcggtg
gactaccaggactggcgcggccttgctgaggatgcccaggagcagcgcctgcaggccctg
cacaagcaggagcgcgaggccggctttgccttgctcagcgaagcaccgttccacctgcgc
ctggtgcgcgtggccgatgaacgctactggttcatgatgagcaaccaccacatccttatc
gatgcctggtgccgctcgctgttgatgaacgatttcttcgaggtctaccaggcccttggc
gaaggccgtcaggcccaactgccggtgccaccgcgttaccgcgattacatcggttggctg
cagcgccagggcctggacgatgcacgcgcctggtggcaggccaacctggctggcttcgaa
cgtgccacagccatcccgagcgaccgcccgctgcgccatgaccacgccggtagcggcatg
gtcgtcggcgactgctacacccgcctggaggtgagtgatggtgtgcgtctgcgcgaactg
gcccaggctcatcagctcaccgtcaacaccttcgcccaggcggcctgggccttggtgttg
gcgcgttacagcggcgaccgcgatgtggcctttggcgtgaccgtggccgggcgcccggtg
agcatgccgcagatgcagcgcaccgttggcctgttcatcaacagcgtggccctgcgcgtg
cagttgcccatcgctggtgagcgctgcagcgtacgccagtggctgcagggcctgctgcaa
agcaacacggaactgcgcgagtacgaatacctgccgctggtggcgatccaggcgtgcagc
gagctgcccaagggccagccgctgttcgacagcctgttcgtgttcgagaatgcgccggtt
gaaaccgccgtgctcgatcacgcccagcacctgaacgccagctccgactcgggccgtacc
cacaccaacttcccgctgacggcggtgtgctacccgggtgatgacctgggcctgcacctg
tcgttcgaccagcgctactttgactacccgaccgtcgagcgcctgctggccgaattcaag
cgcctgctgctggcgctggtacaaggctttgaaggggaggtgagcgagctaccgttgctg
agcgcccaggagcaaggcttcctgctggaggattgcaaccggaccgagcgggtttatccg
ctggaacagagctacatcgcgcagttcgaagcgcaggtcgtggcgcatccacagcgtacc
gtggcccgctgcctggaggcgtcctacgattacgccgggctgaacctggcggccaaccgc
ctgggccatgcgctggtggctgccggggtctgcgtggaccagccagtggcactgcttgcc
gagcgtgggttgccgctgctgggcatgattgtcggcagcttcaaggccggcgccggctac
ctgccgctggacccgggcctgccggcggcgcgcctgcaaagcatcatccagctcagccgc
acgccagtgttggtgtgcagcgcggcctgcgccgagcaggggcggcagttgctcggtgag
ctggaggctgcgctgcggccgcaactgctggtctgggaagacgtccaggccaacccgatc
gcaagccacaacccgggcatccacagtggcccggacaacctcgcctacgtgatctacacc
tcaggctcgaccggcctgccgaaaggggtgatggtcgagcagagcggcatgctcaacaac
cagctgagcaaggtgccttacctggcgctgagcgagcaggacgtgatcgcccagaccgcc
tcgcaaagcttcgacatctcggtctggcagttcctggctgcgccgctgttcggcgccaag
gtagagatcgtgcctaacgccatcgcccacgacccgcagggcctgctggcgcacgtgcag
gccaccggcatcaccgtgctggagagcgtgccgtccctgatccagggaatgctggccagc
gaccaccaggccctcgacggcctgcgctggatgctgccgaccggcgaggccatgccaccg
gagctggcggcgcagtggctgcagcgctacccgcagatcggcctggtcaatgcctatggg
ccggcggagtgctcggatgacgtggcgttcttccgcgtcgatgccgcctcgacccaaggc
agctacctgccaatcggcacgccaaccgataacaaccggctgtacctgttcggcgaggac
caggcactggtgccgctgggtgcggtgggcgagctgtgcgtggctggcacgggtgtaggc
cgtggctacgtcggtgacccggtgcgcacggcgctggcgttcatccctcacccttacggg
gcgccgggcgaacgcctgtaccgcactggcgacctggcgcggcaacgcccggacggtgtg
ctggagtacgtcgggcgcatcgaccatcaggtgaagattcgcggctatcgcatcgagctg
ggcgaaatcgaggcccggctgcatgagcaggcggaaattcgcgatgccgccgtggcggtg
caggagggcgtgaacggcaagcatctggttggctacctggtagcgcaccagggcgtcagt
gccgatgccgcgttgctggagcaggtcaagcaacgactgcgtgccgagttgccggagtac
atggtgccgttgcattggggctggttcgacagcttgccgcacaacgccaacggcaagctc
gaccgcaaggccttgccagccatcgacatcggcggccagtacagtcaggcctatcaggcg
ccacgcaatgaattggaggacgtgttggcgggtatttgggccgatgtgctcaaagccgag
cgggtgggggtgcacgacaacttcttcgagctgggcgggcattcgctgctggccacgcag
atcgcttcgcgggtgcagaagcagctacagctgaacgtgccgctgcgggcgatgttcgag
tgcagcacggtggaggcgttggccgagtatgttcaggggctgcagggcagtgcgctggat
gatgacaaggtcgaccggctcagtgacctgatggcggagctggaggggttgtga

DBGET integrated database retrieval system