KEGG   Pseudopropionibacterium propionicum: HMPREF9154_2106Help
Entry
HMPREF9154_2106   CDS       T02180                                 

Gene name
mdh_1
Definition
(GenBank) malate dehydrogenase
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
ppc  Pseudopropionibacterium propionicum
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HMPREF9154_2106 (mdh_1)
   00620 Pyruvate metabolism
    HMPREF9154_2106 (mdh_1)
   00630 Glyoxylate and dicarboxylate metabolism
    HMPREF9154_2106 (mdh_1)
  Energy metabolism
   00680 Methane metabolism
    HMPREF9154_2106 (mdh_1)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    HMPREF9154_2106 (mdh_1)
Enzymes [BR:ppc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     HMPREF9154_2106 (mdh_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2301311..2302333)
Genome map
AA seq 340 aa AA seqDB search
MDITVERKVRTMSTEAPVKIAVTGAAGQICYSLLFRIASGSLLGDRPIELRLLEITPALK
ALEGVVMELDDCAFPNLKNVVIGDDPKKVFDGVNLAMLVGAMPRKAGMERGDLLSANGAI
FTAQGKALNEVAADDVRVLVTGNPANTNALIASSNAPDIPKERFNALTRLDHNRAKSQLA
QKLGCPVEEIKKMTIWGNHSSTQYPDIFHAEVGGKNAAGLVNDEAWIESTFIPTVAKRGA
AIIEARGLSSAASAANATVEHMRDWVLGTPDGDWVSMAIPSDGSYGVAEGVISSFPCVVK
NGKYEIVQGLEIDPFSRTKIDASVAELLDERKAVKELGLI
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtggacatcaccgtcgaaagaaaggtccgcacgatgagcactgaggctcccgtcaagatc
gcagtgaccggcgcagccggccagatctgctacagcctgctgttccggatagccagcggt
tccctgctgggcgatcggcccatcgagctgcgtctgctggagatcaccccggccctgaag
gccctggagggtgtcgtcatggaactcgacgactgcgccttcccgaacctgaagaacgtc
gtcatcggcgatgacccgaagaaggtcttcgacggcgtcaacctggcgatgctggtcggc
gccatgccccgcaaagccggcatggaacgcggcgacctgctgagcgccaacggcgccatc
ttcaccgcccagggcaaggccctgaacgaggtggccgcggacgacgtccgtgtgctggtg
accggcaaccccgccaacaccaacgcgctgatcgcatccagcaacgcccccgacatcccg
aaggagcgtttcaacgccctcacccgcctggaccacaaccgcgcgaagtcccagctcgcc
cagaaactcggctgccccgtcgaggagatcaagaagatgaccatctggggcaaccactcc
tccacccagtaccccgacatcttccacgccgaggtgggcgggaagaacgccgccggactg
gtgaacgacgaggcctggatcgagtccaccttcatcccgacggtcgccaagcgcggcgca
gccatcatcgaggcccgtggcctgtcgtccgctgcctccgcggcgaacgccaccgtcgag
cacatgcgtgactgggtgctcggcacccccgacggcgactgggtttccatggcgattccc
tccgacggctcctacggggtcgccgagggcgtcatctcctccttcccgtgcgtggtcaag
aacggcaagtacgagatcgttcagggtctcgagatcgacccgttctcccgcaccaagatc
gacgcctccgtcgccgaactgctcgacgagcgcaaggcggtcaaggaactcggcctgatc
tga

DBGET integrated database retrieval system