KEGG   Pseudopropionibacterium propionicum: HMPREF9154_2191Help
Entry
HMPREF9154_2191   CDS       T02180                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ppc  Pseudopropionibacterium propionicum
Brite
Enzymes [BR:ppc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     HMPREF9154_2191 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AFN47345
UniProt: I6Y5D0
LinkDB All DBs
Position
2387822..2388427
Genome map
AA seq 201 aa AA seqDB search
MTYVLPDLDYDYGALAPHIAPEIMELHHSKHHATYVAGANTALEQLAEARESGNFGGINK
LEKDLAFHLGGHINHSTFWKNMSPEGGGRPDGELAAAIDEYFGGFDGFQKQFNAAANGIQ
GSGWSMLVFDTLGRRLNINQLYDQQGNLPAGQIPLLQLDMWEHAFYLQYKNVKGDYVNAW
WNVVNWPDVAERFIKAQSFAS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgacctacgtcctgcccgatctcgactacgactacggcgcgctggccccgcacatcgcc
ccggagatcatggagttgcaccacagcaagcaccacgccacctacgtggcgggggcgaac
acggccctggagcagctggccgaggctcgcgagtccggcaatttcggcggcatcaacaag
ctggagaaggatctggccttccacttgggcggacacatcaaccattccacgttctggaag
aacatgtcgccggagggcggcggccgtcccgatggtgagctggccgcggccatcgacgag
tacttcggtggtttcgacggtttccagaagcagttcaacgccgccgccaacggcatccag
ggttccggctggtccatgctggttttcgacaccctcgggcggcgtctcaacatcaaccag
ctgtatgaccagcagggcaaccttccggcgggccagatcccgctgctgcagctcgacatg
tgggagcacgccttctacctgcagtacaagaacgtgaagggtgactacgtcaacgcctgg
tggaacgtggtcaactggcccgacgtcgccgagcgcttcatcaaggcccagtccttcgcg
tcctga

DBGET integrated database retrieval system