KEGG   Pelobacter propionicus: Ppro_0452Help
Entry
Ppro_0452         CDS       T00436                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP)
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ppd  Pelobacter propionicus
Pathway
ppd00020  Citrate cycle (TCA cycle)
ppd00480  Glutathione metabolism
ppd01100  Metabolic pathways
ppd01110  Biosynthesis of secondary metabolites
ppd01120  Microbial metabolism in diverse environments
ppd01130  Biosynthesis of antibiotics
ppd01200  Carbon metabolism
ppd01210  2-Oxocarboxylic acid metabolism
ppd01230  Biosynthesis of amino acids
Module
ppd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppd_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ppd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ppro_0452
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Ppro_0452
Enzymes [BR:ppd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Ppro_0452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ABK98084
UniProt: A1AL64
LinkDB All DBs
Position
475085..476497
Genome map
AA seq 470 aa AA seqDB search
MNYTYLTVPQGEKISMGSDGKLRVPANPIIPFIEGDGTGPDIWRAAKRVLDAAVARAYGG
ARKISWMEVFAGEKSFNMFRESMGDRAWLPDETVDAYREFLVGIKGPLTTPIGGGIRSLN
VALRQLLDLYVCLRPVRYFQGVPSPVKKPQDVDMVIFRENTEDIYAGIEWMQGTTECEKL
KRFLLEEMKVTNIRFPGSVSLGVKPISKEGSQRLVRAAIDYALEQGRRSVTLVHKGNIMK
YTEGAFKEWGYQVATEQFRDRVVTERESWIIANQDKNPTMAPEENARLIEPGYDLMTPNQ
RQRIVDEVQAALGLMATHGNGQWKKLLLIKDSIADIALQQVLTRAKEFDVIATMNLEGDF
LSDALAAQVGGIGIAPGANINYLTGHAIFEATHGTAPKYANQDKVNPGSVILSGVMMLEY
LGWREAADLVIAAIDRTISQKKVTYDFERLMEGATLVSCSGFADALIGNM
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaactacacctacctcacggtcccgcagggagagaagatcagcatggggagcgacggc
aagcttcgggtccccgccaaccccatcatcccgttcatcgagggagacggcaccggcccc
gacatctggcgggcggcgaagagggtgttggacgccgccgttgccagggcctatggcgga
gcacggaagatcagctggatggaggtctttgccggcgagaagtccttcaacatgttcagg
gagagcatgggagaccgggcctggctgccggacgagaccgtggatgcctaccgcgagttc
ctggtgggcatcaaggggcccctgaccacccccatcggcggcggcatccgctcgctgaac
gtggctttgcgccagcttttggacctgtacgtctgcctgcggccggtgcgctacttccag
ggggtgccgtcgccggtgaagaaaccccaggacgtggacatggttattttccgggagaac
acggaggacatctacgccggtatcgagtggatgcagggcacaaccgagtgcgaaaaactc
aagagattcctgctggaggagatgaaggtcaccaatatccgcttcccgggcagcgtctcc
ctgggggtcaagccgatttcaaaggaggggtcccagcgcctggtcagggccgccatcgat
tatgccctggagcagggacggcgctcggtcaccctggtgcacaaggggaacatcatgaag
tacaccgagggggccttcaaggagtggggctaccaggtggctaccgaacagttccgcgac
cgggtggtcaccgaacgggagagctggatcatcgccaaccaggacaagaaccccaccatg
gcgccggaggagaacgcccggctgatcgaaccgggctatgacctgatgacgcccaaccag
cgccaaaggatcgttgacgaggtgcaggccgccctggggctgatggcgacccacggcaac
ggccagtggaagaaactcctgcttatcaaagactccatcgccgatatcgccctgcagcag
gtactgacccgcgccaaagagttcgacgtcatcgccaccatgaatctggagggggacttc
ctctccgacgccctggcagcccaggtgggcggcatcggcatcgctccgggtgccaacatc
aactacctgaccggccacgccatcttcgaggccacccacggcacggcgcccaagtacgcc
aaccaggacaaggtcaaccccggttcggtgatcctctccggcgtgatgatgctggagtac
ctgggatggcgggaggctgccgacctggtcatcgccgccatcgacaggaccatctcccag
aagaaggtcacctacgacttcgagcgtctgatggagggggccaccctggtgagctgctcc
ggcttcgccgacgctctgatcgggaatatgtga

DBGET integrated database retrieval system