KEGG   Paenibacillus peoriae: ABE82_24470Help
Entry
ABE82_24470       CDS       T04053                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
ppeo  Paenibacillus peoriae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppeo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ABE82_24470
Enzymes [BR:ppeo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ABE82_24470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5683374..5684867
Genome map
AA seq 497 aa AA seqDB search
MKRNHTMMQFFEWNVEADGSHWKKLTRLAPELKAKGIDAIWIPPVTKGQSPEDTGYGVYD
LYDLGEFDQKGAVRTKYGTREDLLEAVAACVRHGVAVYVDLVMNHKAGADETEVFKVVEV
NPDNRNEVISEPFDIEGWTKFTFPGRQGQYSTFQWNFEHFNGTDYDASQDRTGIYRILGK
NKSWSENVDDEFGNYDYLMFANIDYNHQDVRKEMIRWGKWLVDTLQCNGFRLDAIKHINH
EFVREFATEMIKKRGQDFYMVGEFWKPDLESCQKFLDTIDYKIDLFDVSLHYKLHSASLG
GKDFDLSTIFEDTLVHTHPLNSVTFVDNHDSQPHEALESWVEDWFKPSAYALILLRKDGY
PCVFYGDYYGIQGQTPVKGKQAELDPLLYARYHKAYGEQKDYFDDPHTIGWVRQGVPELE
GSGCAVVITNANDGEKRMFVGKQHAAEEWIDLTGRHDHTVKIEQDGYGIFPVRAGSVSVW
ALPAEEDSQETEEEANA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggaaccatacgatgatgcaatttttcgagtggaatgtcgaagctgacggttct
cactggaagaagcttacccgcctggcaccggaactgaaagccaaaggaattgacgcgata
tggattccacctgtcaccaaaggccaatcgcccgaggatacgggatacggcgtctatgac
ctttatgatctgggcgaatttgaccaaaaaggtgcggtgcgcaccaaatacggaaccagg
gaagacctgctggaggctgttgccgcctgcgttcgccacggtgtggccgtctatgtcgat
ctggttatgaaccataaggctggcgcggatgaaaccgaagtgttcaaggtcgtcgaggtc
aatccggataaccgcaatgaggtcatttccgagccctttgatatcgagggctggactaaa
tttacgttccccggccgtcaaggtcagtattccacatttcaatggaactttgaacatttt
aacggaaccgattacgatgcaagccaggaccggacaggaatctatcgtattttaggtaaa
aataaaagctggagcgaaaatgtagatgatgaattcggcaattatgattatttaatgttc
gccaatattgattataatcatcaggatgtgcgcaaagagatgatccgctggggcaaatgg
ctggtagatactctgcaatgcaacggattccgtctggatgcaatcaagcatattaatcat
gaatttgtacgagagtttgctacagaaatgattaaaaaacgcggacaggatttttatatg
gtaggcgagttttggaaaccggatctggaatcgtgtcaaaagttcctggataccattgat
tataaaatcgacctatttgacgtatccctccactacaaactacatagcgcttccttgggt
ggcaaggatttcgatttaagcaccattttcgaggatacgcttgttcatacccatcccctg
aactcggttacttttgtcgataatcatgattcccagccgcatgaagcgcttgaatcctgg
gtggaggactggttcaagcccagcgcctatgcacttatcttgctgcgcaaggacggttat
ccctgcgtattctatggcgattactacggcatccagggacaaacgcccgtcaaaggcaag
caggctgagctagacccgcttctatatgcccgataccataaagcttatggtgagcaaaaa
gattatttcgatgatccccatacgattggatgggttcgtcaaggcgtgcctgagctggaa
ggctccggatgtgctgtggtgatcaccaacgcaaatgacggagaaaagcgcatgttcgta
ggcaaacaacatgcagcggaagaatggatagatttgaccgggcgtcacgatcataccgta
aagattgagcaggatggctacggcatatttcccgttcgtgccggcagtgtatcggtgtgg
gcacttcccgcagaggaagacagccaggaaacagaagaagaagcgaacgcttaa

DBGET integrated database retrieval system