KEGG   Prunus persica (peach): 18771791Help
Entry
18771791          CDS       T03092                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pper  Prunus persica (peach)
Pathway
pper00010  Glycolysis / Gluconeogenesis
pper00051  Fructose and mannose metabolism
pper00052  Galactose metabolism
pper00500  Starch and sucrose metabolism
pper00520  Amino sugar and nucleotide sugar metabolism
pper01100  Metabolic pathways
pper01110  Biosynthesis of secondary metabolites
pper01200  Carbon metabolism
Module
pper_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pper_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pper00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    18771791
   00051 Fructose and mannose metabolism
    18771791
   00052 Galactose metabolism
    18771791
   00500 Starch and sucrose metabolism
    18771791
   00520 Amino sugar and nucleotide sugar metabolism
    18771791
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    18771791
Enzymes [BR:pper01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     18771791
Membrane trafficking [BR:pper04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    18771791
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 18771791
NCBI-ProteinID: XP_007203872
UniProt: M5VVH3
LinkDB All DBs
Position
G7
AA seq 498 aa AA seqDB search
MGKVAVGAAVVCAAAVCAAAALVVRHRMKCSGRWARAMAILREFEDKCGTPIGKLRQVAD
AMTVEMHAGLASEGGSKLKMLISYVDNLPTGDEQGLFYALDLGGTNFRVIRVQLGGKEKR
VVKQEFDEVSIPPNLMTGTSEALFDFIAEALAKFVATEGEGFHPAPGRQRELGFTFSFPV
WQTSIASGTLIKWTKGFNIEDAVEQDVVGELTKSVEKIGLDMRVTALVNDTIGTLAGGRY
HNQDVIAAVILGTGTNAAYVERAHAIPKWHGLLPKSGEMVINMEWGNFRSSHLPLTEYDQ
ALDAESLNPGDQIFEKIISGMYLGDIVRRVLCKMAEEASFFGDVVPPKLKVPFILRTPDM
SAMHHDTSPDLRVVGSKLKDILEISNTSLKMRKVVVALCDIVATRGARLSAAGIMGVLKK
LGRDTVKEGEKQKSVVALDGGLYEHYTEFRTSMESTLKELLGDEVAEHISVEHSNDGSGI
GAALLAASHSQYLEVEES
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggtggcggtgggggcggcggtggtgtgcgcggcggcggtgtgtgctgcggcg
gcgctggttgtacgacaccgtatgaagtgctcggggaggtgggcccgggctatggcgata
ctgagggagttcgaggataagtgtgggacccccattgggaagctgagacaggtggctgac
gccatgactgtggaaatgcacgctggcctcgcatccgaaggcggcagcaagctcaagatg
ctcatcagctacgtcgataacctccccactggggatgagcaagggctgttttatgcattg
gaccttggtgggacaaacttccgtgtcatacgtgtacagcttggtgggaaagaaaaacgt
gttgttaaacaagaatttgacgaagtttcaattccaccaaatttgatgactgggacttca
gaagcattatttgattttattgctgaagcacttgcaaaatttgttgctacggaaggagaa
ggttttcatcctgctcctggtagacaaagggagctgggttttaccttttcatttcctgtg
tggcaaacatcaatcgcatcaggaacccttattaagtggacaaaaggcttcaatattgaa
gacgcggttgagcaagatgtggtgggagagctgaccaaatcagtggaaaaaattggcctt
gatatgcgtgttacagctttggtcaatgatacaattggtacattagcaggaggtagatac
cacaatcaggatgtcattgctgctgtgatattgggcactgggacaaatgctgcttatgta
gaacgggctcatgccattccaaaatggcatggtcttctacctaaatcaggagagatggtt
atcaacatggagtggggtaactttcgctcatcacaccttccactgacagaatacgatcaa
gcacttgatgctgagagtttaaatcctggggatcagatctttgagaagatcatttctggc
atgtatttaggggacattgtgcgcagagtattgtgcaagatggctgaagaagcttccttt
tttggtgatgttgtccccccaaaactgaaagttcctttcatactaaggactcctgacatg
tctgccatgcatcatgacacttctccggatctgagagtggttgggagcaaactaaaggat
atcctggagatctccaacacctcgttgaaaatgagaaaggttgttgtggcgctatgtgac
atagttgccactcgtggggcccgcctatctgctgctgggatcatgggagtgctgaagaag
ttaggtagagacacagtaaaggagggagagaagcaaaagtcggttgtagcattggatggt
ggtttgtatgagcactacaccgaattccgaaccagcatggagagcactctcaaggagttg
ctgggtgatgaagttgctgagcacatttccgtcgagcactcaaacgatggctccggaatt
ggagctgccctcctggcagcctctcactcccagtaccttgaggtagaggagtcataa

DBGET integrated database retrieval system