KEGG   Prunus persica (peach): 18791020Help
Entry
18791020          CDS       T03092                                 

Definition
(RefSeq) probable glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pper  Prunus persica (peach)
Pathway
pper00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pper00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    18791020
Enzymes [BR:pper01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     18791020
Transporters [BR:pper02000]
 Other Transporters
  Pores ion channels [TC:1]
   18791020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_N_4 GST_C
Motif
Other DBs
NCBI-GeneID: 18791020
NCBI-ProteinID: XP_007226113
UniProt: M5XMI3
LinkDB All DBs
Position
G1
AA seq 224 aa AA seqDB search
MATDKVKLLGYVFSPFSRRVEWALKLKGIDYEYVEEDIFNKSPLLLQLNPVRKKVPVLVH
GNEVVSESFTILEYIDETWKQNPLLPQDPYARAISRFWANFTEEKVLDAGFTALICSTGE
QQEKALKSTIEALEHIEGDLMGKKILGGESIGYLDIAMGWISYWLPIWEEVGSRQVLDPS
KFPATISWINKILSHPVIKDNLPPRDKAVAYFHGRRNFYTSGKT
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagataaggttaagcttttagggtatgttttcagtccattttcccgtagagtg
gagtgggctctgaagctgaagggcattgattatgagtatgtagaagaagatatcttcaac
aaaagccctcttcttctgcaactcaatccagttcgcaaaaaagttccggttttggttcat
ggcaacgaagtggtctctgagtcattcactattcttgaatatattgatgagacatggaag
caaaacccattgttgcctcaagatccttatgcaagagccatatcacgcttttgggctaac
ttcacggaagagaaggttctggatgctggatttacagctttaatatgctccacaggagag
caacaagaaaaggctttgaaatcaactattgaggccttggaacacatagaaggagacctc
atgggaaagaagattttaggaggggaaagcattgggtatttggacattgcaatgggatgg
atctcttactggctgcctatttgggaggaagtaggctccaggcaggttttggacccttca
aaatttcctgcaaccatttcatggatcaacaaaattcttagccaccctgtgatcaaggac
aacttacctcctcgagacaaagcggttgcttattttcatgggaggagaaatttttacact
tctgggaagacttag

DBGET integrated database retrieval system