KEGG   Pseudomonas putida F1: Pput_0473Help
Entry
Pput_0473         CDS       T00537                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ppf  Pseudomonas putida F1
Brite
Translation factors [BR:ppf03012]
 Eukaryotic Type
  Elongation factors
   Pput_0473
 Prokaryotic Type
   Pput_0473
Mitochondrial biogenesis [BR:ppf03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Pput_0473
Exosome [BR:ppf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Pput_0473
  Exosomal proteins of breast cancer cells
   Pput_0473
  Exosomal proteins of colorectal cancer cells
   Pput_0473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: ABQ76643
JGI: Pput0473
UniProt: A5VXN3
LinkDB All DBs
Structure
PDB: 

Jmol
Position
547827..549020
Genome map
AA seq 397 aa AA seqDB search
MAKEKFDRSLPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSAIVEFDKIDSAPEEKARG
ITINTAHVEYNSTIRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADLVDDAELLELVEMEVRDLLSTYDFPGDDTPIIIGSARMALE
GKDDNEMGTTAVKKLVETLDSYIPEPVRAIDQPFLMPIEDVFSISGRGTVVTGRIERGIV
RVQDPLEIVGLRDTTTTTCTGVEMFRKLLDEGRAGENCGVLLRGTKRDDVERGQVLVKPG
SVKPHTKFTAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNCELPEGVEMVMPGDNI
QMTVTLIKTIAMEDGLRFAIREGGRTVGAGVVAKIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggaaaagtttgatcgttcccttccccacgttaacgtcggcactatcggccac
gttgaccacggtaagaccactctgaccgcagctctgactcgcgtttgctccgaagttttc
ggttcggcaatcgttgagttcgacaagatcgactcggctccggaagaaaaagcgcgcggt
atcaccatcaacaccgctcacgttgagtacaactcgaccattcgtcactacgctcacgtt
gactgcccaggtcacgctgactacgtgaagaacatgatcaccggtgctgcccagatggac
ggcgcgatcctggtttgctcggccgccgatggtccgatgccacaaacccgtgagcacatc
ctgctgtcccgtcaggtgggcgttccgtacatcgtggtcttcctgaacaaggctgacctg
gtagatgacgctgagctgctggaactggtcgagatggaagttcgcgacctgctgtccacc
tatgacttcccaggcgacgacaccccgatcatcatcggttcggctcgtatggcgctggaa
ggcaaagacgacaacgaaatgggcactaccgctgttaagaagctggtagaaactctggac
agctacattcctgagccagttcgtgctatcgaccagccgttcctgatgccgatcgaagac
gtgttctcgatttcgggtcgtggtaccgttgttaccggtcgtatcgagcgtggtatcgtc
cgcgttcaggatccgctggaaatcgttggtctgcgtgacaccaccaccaccacctgcacc
ggtgttgagatgttccgcaagctgctggacgaaggtcgtgctggcgagaactgcggcgtt
ctgctgcgtggcaccaagcgtgacgacgttgagcgtggtcaggttctggtcaagccaggt
tcggtcaagccgcacaccaagttcaccgcagaagtctacgtcctgtcgaaggaagaaggc
ggccgtcacacgccgttcttcaaaggctaccgtccacagttctacttccgtaccactgac
gtgaccggtaactgcgaactgccggaaggcgttgaaatggtaatgccaggtgacaacatt
cagatgactgttaccctgatcaagaccatcgcaatggaagacggtctgcgcttcgctatc
cgtgaaggcggtcgtaccgtcggcgccggtgtcgtggcaaaaattattgaataa

DBGET integrated database retrieval system