KEGG   Pseudomonas putida GB-1: PputGB1_3809Help
Entry
PputGB1_3809      CDS       T00650                                 

Definition
(GenBank) amino acid adenylation domain protein
Organism
ppg  Pseudomonas putida GB-1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(4237459..4250412)
Genome map
AA seq 4317 aa AA seqDB search
MTDAFELPLSLVQALAQRAAQTPDKIALRFLADAPGEQAVLSYRDLDQRARTIAAALQAR
AGFGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESARQHHQERLLSIIDDAEPRLL
LTVAALHDSLQGLEALAADNAPELLAVDGLDPVLAASWQAPALKGDDIAFLQYTSGSTAL
PKGVQVSHGNLVANEQLIRCGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVL
MSPGYFLARPLRWLQAISEYGGTISGGPDFAYRLCSERVSEASLSGLDLSRWRVAYSGSE
PIRQDSLATFADKFQACGFDPQSFFASYGLAEATLFVSGSRRGQGIAALELDADAFAANR
AEPGTGSVLMSCGYPQPGHAVRIVEPQQLQVLGDNQVGEVWAGGPSIALGYWRNPEASAR
TFVEMDGQTWLRTGDLGFMREGEVFVTGRLKDMLIVRGQNLYPQDLERTLEREVEVLRKG
RVAVFAVEHQGEEGIGVAVEISRNVQKAIKPQDLIKTLRQVIADACRQAPAVVLLLNPGA
LPKTSSGKLQRSACRLRMDDGSLDCYARFPEASEAIASEAAGDELQARIAAVWRDILKVE
AVAADDHFLLLGGNSIAATQATARLADELGINLNLRVLFEAPVLADYSKAVGAIIVEGGA
HPAAIATLARAQALPQSLAQNRLWLMWQLEPQSAAYNIPAGLHLRGELDVVALEAAFEAL
VARHESLRTVFSEENGQALQRIRPQQPFSLHRLDLEGHSTEQVVAQREAEARQPFDLTQG
PLLRVTLVRLGDEDHQLWVTLHHIVADGWSLNILLDEFAKLYAARCQGLEANLAPLTLGY
ADYGTWQRQWLADGEAERQLQHWKAQLGDELPVLDLCTDHPRASQRQHSAARFNLKVPAK
LGDALKGLAREQQASLFMVLLAGWQALLQRYSGQADIRVGVPNANRPRLETQGMVGFFIN
TQVLRAQFEGRQSFTQLLAQVRQATLQAQANQDLPFEQLVEALPEAREQGLFQVMFNHQQ
RDLSALRRLPGLLAEELPWHSREAKFDLQLHSEEDHQGRLSLAFDYAAELFEASTVKRLA
QHLLALLEQVCSAPQRALGEVQLLDEPARAQLLGWGQAAAAAPQHLLVEQLNEQARLTPQ
RTALVWEGGSLDYAELHQQANRLAHYLRDKGVGPDTCVAIAIERSPQLLVGLLAILKAGG
AYVPLDVDYPAERLAYMLADCNAGLLLSHSSLLGKLPQVAGVSAIALDQLHLDSWPSQAP
GLHLHGDNLAYVIYTSGSTGQPKGVGNTHAALAERLQWMQATYALNDSDVLMQKAPISFD
VSVWECFWPLITGCKLVLAGPGEHRDPQRIAALVQAQGVTTLHFVPPLLQVFIQEPQAGA
CSSLRRLFSGGEALSAALRDRVLQVLPQVQLHNRYGPTETAINVTHWHCQAADGERSPIG
RPLGNVLCRVLDDELELTAPGVPGELYLGGAGLARGYLGRPGLTAERFVPQADGNGQRLY
RSGDRARWQVQLEALEYLGRLDQQVKVRGFRVEPEEVQACLLAQAGVEQALVLIHKGAIG
AQLVGYYSGSAQPADLLAVLAEQLPAYMVPAQLIALAQMPLGPSGKVERKALPAPVWQQR
EHVEPQTELQQQVAAIWCEVLNVPRIGLQDDFFALGGHSLLATQIVSRTRQACDVELPLK
ALFDASELGTFCAEIARIRAAGERNLQGDIARVDRRQAVPLSYSQQRMWFLWQMEPDSPA
YNVGGMARLRGTLHVDAFERALQALIVRHETLRTTFPSIDGVPYQCVAEDSGLHLDWQDF
SALSADARQQRLQQLADDQAHQPFDLERGPLLRACLVKAEEREHYFVLTLHHIVTEGWAM
DIFARELGELYEAFVDDRESPLAPLPVQYLDYSVWQRHWLESGEGARQLAYWKDRLGDEH
PVLALPADRPRPAVQSHRGELYRFELDPALVARVHAFNSQRGLTLFMTMTATLAALLHRY
SGQRDLRIGAPMANRIRPESEGLIGAFLNTQVLRCELDGQMTASELLEQMRQAAIEGQSH
QDLPFDQLVEALQPPRSSAYNPLFQVMCNVQRWAFQQSRTLAGMQVDYLVNDASATKFDL
YLEVTDLDGRLGCCLTYSRDLFDEPRIARMAEHWQQLLVGLLDNPQQRLCELPMLSSAEQ
QVLVGQLQGEHDFELDQTLHGLFAAQAARTPQAGALTFAGQHMTYAELDQQANRLARALR
ERGVGPQVRVGLALERSLEMVVGLLAILKAGGAYVPLDPEYPLDRLRYMIEDSRIGLLIS
QRELLKTLGELPQGVARWSLEDDAASLSAYSDAPLDNLNLPQHQAYLIYTSGSTGKPKGV
VVSHGEFAMHCQAVIAAFGMRSDDCELHFYSINFDAASERLWVPLLCGARVVLRAQGQWG
AEDICQLVREQQVSILGFTPSYGSQLAQYLGGQGEQLPVRLVITGGEALTGEHLQRIRQA
FAPQQFFNAYGPTETVVMPLACLAPEALPADLGSVPIGRVIGSRTAYILDEDLALLPQGG
IGELYVGGAGLAQGYHDRPGLSAERFVADPFSPAGGRLYRTGDLVRLGIDGLVEYVGRAD
QQVKIRGFRIELGEIESRLQAHLDVDEAVVLALDLPGGKQLVGYLVCKQASAGSEAQNLL
REAVKADARQHLPDYMVPAHLVLLDSLPLMGNGKLDRRALPLPDLEQARQQYQAPGNEVE
AQLAQIWRDVLNVAQVGVQDNFFELGGDSILSIQVVSRARQAGLQFTPRDLFQHQTIQTL
AAVVQHSEAASSIDQGQRQGQTGLTPIQHWFFDSEVPQPQHWNQAVLLEARQPLDEAALA
QAMAALVQHHDSLRLRFSEAQGGWQAQYAQPAGDQLLWSATVADFADCQALYTDLQRSLD
LQQGPLLRGLLVRDGQGSQRLLLAIHHLVVDGVSWRVLLEDLQALYRGQPLPTKTHAMGD
WAARLASYAGSDSLRDELGWWQGQLGGVRRELPCDHPQGGNLHRHAHTLAIGLDVEQTRQ
LLQQAPAAYHTQVNDLLLTALARALCRWSGEEEVLVQLEGHGRDGLFEDMDLTRSVGWFT
NAYPLSLRPLPGEDDAARAGSIKRIKEQLRQVPHKGLGYGVLRYLADAAGREQMAALPQA
RITFNYLGQFDQQFDSTALFQPLEAPAGLAHDLDAPLPNWLSVDGQVYGGALQMRWTYSA
ERYDQQTIARLAEAYRQELLTLVAHCLADGNGSFTPSDFPLAHLTQAQIDALPVPAAQIE
DVYPLTPMQEGMLLHTLLEPGTGLYYMQDRYRINSALDPERFAQAWQAVVARHEALRASF
SWNSGEAMLQIIHKPGNLAVDYQDWRGLADDAQEQRLQALHKQEREAGFALLSEAPFHLR
LVRVADERYWFMMSNHHILIDAWCRSLLMNDFFEVYQALGEGRQAQLPVPPRYRDYIGWL
QRQGLDDARAWWQANLAGFERATAIPSDRPLRHDHAGSGMVVGDCYTRLEVSDGVRLREL
AQAHQLTVNTFAQAAWALVLARYSGDRDVAFGVTVAGRPVSMPQMQRTVGLFINSVALRV
QLPVAGERRSVRQWLQGLLQSNMELREYEYLPLVAIQECSELPKGQPLFDSLFVFENAPV
ETAVLDHAQHLNASSDSGRTHTNFPLTAVCYPGDDLGLHLSFDQRYFDYPTVERLLAEFK
RMLLALVQGFEGEVSELPMLGADEQRFLLEDCNRTERAYPLEQSYIAQFEAQVAAHPERT
VARCLEASYDYAGLNLAANRLGHALIWAGVKVDQPVALLAERGLPLLGMIVGSFKAGAGY
LPLDPGLPAARLQSIIQLSRTPVLVCSAACAEQGRQLLAELNVAPRPQLLVWEDIQASQV
ASHNPGIHSGPDNLAYVIYTSGSTGLPKGVMVEQRGMLNNQLSKVPYLALSEQDVVAQTA
SQSFDISVWQFLAAPLFGAKVEIVPNAIAHDPQGLLAHVQATGITVLESVPSLIQGMLAS
DHQALDGLRWMLPTGEAMPPELAAQWLQRYPQIGLVNAYGPAECSDDVAFFRVDAASTQG
SYLPIGTPTDNNRLYLFGEDQALVPLGAVGELCVAGTGVGRGYVGDPLRTALAFIPHPYG
APGERLYRTGDLARQRPDGVLEYVGRIDHQVKIRGYRIELGEIEARLHEQAEIRDAAVGV
QEGVNGKHLVGYLVAHQGIAADAALLEQVKQRLRAELPEYMVPLHWSWFDSLPHNANGKL
DRKALPAIDIGGQHSQAYQAPRNELEEVLAGIWADVLKAERVGVHDNFFELGGHSLLATQ
IASRVQKQLQLNVPLRAMFECSTVEELAEYVQGLQGSALDDDKVDRLSDLMAELEGL
NT seq 12954 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgccttcgaactcccgctctcgctggtccaggccctggcgcaacgcgccgcg
caaaccccggacaagattgccctgcgctttctggccgacgcccccggcgagcaggccgtg
ctcagctaccgggacctcgaccagcgtgcgcgcaccatcgccgccgccttgcaggcccgt
gccggtttcggcgaccgtgcagtgctgctgttccccagtggcccggactacgtggcggcg
ttctttggctgcctgtatgcgggcgtcatcgcggtaccggcctacccgccggaatcggca
cgccagcaccatcaggagcgcctgttgtcgatcatcgacgacgccgaaccgcgcctgctg
ctgaccgtggcggccttgcatgacagcctgcaaggcctggaggcactggcagcagacaac
gcgcccgagctgctggctgtggacggcctggacccggtgctggccgcgagctggcaggcg
cccgcgctgaagggggatgacattgccttcctgcagtacacctccggctccaccgcgttg
cccaagggcgtgcaggtcagccatggcaacctggtggccaacgagcagctgatccgttgt
ggcttcggcatcgacctcaaccccgacgatgtgatcgtcagctggttgccgctgtaccac
gacatgggcctgattggcggcctgttgcagccaattttcagtggtgtgccctgcgtgctg
atgtcgccaggttacttcctggcccggccgctgcgttggttgcaagccatcagcgagtat
ggcggcaccattagcggcggcccggatttcgcctaccgcctgtgcagcgagcgggtcagc
gaggcctcgctcagcgggctcgacctgagccgctggcgcgtggcctattccggctccgag
ccgatccgccaggacagcctggcgaccttcgccgacaagttccaggcctgcggcttcgac
ccgcagagcttcttcgccagctatggtctggccgaagccaccctgttcgtcagtggcagc
cgccgtggccagggcattgcagcactggagctggatgccgacgccttcgctgccaaccgc
gccgagccgggcacaggcagcgtactgatgagctgcggctacccgcagcctgggcacgcc
gtacgcatcgtcgagccgcagcagttgcaggtgctgggcgacaaccaggttggcgaagtc
tgggccggtggcccgagcattgccctgggctactggcgcaaccctgaggccagcgcccgt
acgttcgtcgaaatggacggccagacctggctgcgtaccggcgaccttggcttcatgcgt
gagggcgaggtgttcgtgactgggcgcctgaaagacatgctgatcgtgcgtgggcagaac
ctgtacccacaggacctggaaagaaccctcgagcgcgaagtcgaagtgctgcgcaaaggc
cgcgtggccgtgttcgctgtcgagcaccagggcgaggagggcatcggcgtggcggtggag
atcagccgcaacgtgcaaaaggcaatcaagccccaggacctgatcaagaccctgcgccag
gtcatcgctgacgcctgccgccaggccccggccgtggtcctgctgctgaaccccggtgcg
ctgccgaagacctccagcggcaagttgcagcgctcggcctgccgcctgcgcatggacgat
ggcagcctggactgctatgcccgtttccctgaagcgagcgaagccattgccagtgaagct
gccggtgatgaactgcaagcacgcatcgctgcggtgtggcgtgacatcctcaaggtagag
gcggtggcagcagatgatcacttcctgctgctgggtggcaactccattgccgctacccag
gccactgcgcgcctggccgatgagctgggtatcaacctgaacctgcgggttttgttcgag
gcgccggtactggccgactacagcaaagccgtcggcgcaatcatcgtcgaaggcggtgcc
caccccgcagccatcgccaccttggcgcgtgcccaggcgttgccccagtcgctggcgcaa
aaccgcttgtggctgatgtggcagttggaaccacaatcggcggcctacaacatcccggcc
ggcctgcatctgcgtggcgagctggacgtagtggcgctggaagcggccttcgaggcactg
gtggcgcgccacgaatcgctgcgtaccgtgttcagtgaggaaaacggtcaggcgcttcag
cgcatcaggccgcagcagccgttcagcctgcaccgcctggatctggaagggcactcgacc
gaacaggttgtagcgcagcgagaagccgaggcccgtcagccgttcgacctgacccagggg
ccactgctgcgagtaaccctggtacgcctgggcgacgaagaccatcagctgtgggtgacc
ctgcaccacatcgttgccgacggctggtcgctgaacatcctgctcgacgaattcgccaag
ctgtacgctgctcgctgccaaggcctggaggccaacctggcgccgctgacactgggttac
gccgactatggcacctggcagcgccaatggctggccgacggtgaagccgaacgccaactg
caacactggaaggcgcagctgggcgatgagttgccggtgctcgacctgtgcaccgaccac
ccccgcgccagccagcgccagcacagcgctgcgcgcttcaacctcaaggtgcccgccaag
ctcggcgacgcgctcaagggcttggcccgtgagcagcaagccagcctgttcatggtcctg
ctggccggttggcaggcgctgctgcagcgctacagcggccaggccgatattcgcgtcggg
gtgcccaacgccaaccgtccgcgcctggaaacccaaggcatggtcggcttcttcatcaac
acccaggtgctgcgcgcacagttcgagggtcgccagtcgttcacccagttgctggcccag
gtacgccaggccactttgcaagcccaggctaaccaggacctgccgttcgaacagctggtc
gaagccctgcccgaggcgcgtgaacagggcctgttccaggtcatgttcaaccaccagcaa
cgcgacctgtcagcgctgcgccgcctgccggggctgctggccgaagagctgccgtggcat
agccgcgaagccaagttcgacttgcagctgcacagtgaagaagaccaccagggccgcttg
agcctggccttcgactatgccgccgagctgttcgaagcgagtaccgtcaagcgcctggcc
cagcacctgctggcgctgctggagcaagtgtgcagtgcgccgcaacgggcgttgggcgag
gtgcagttgctcgatgagccagcccgtgcacagctgctgggttggggccaggctgctgcc
gccgcaccgcagcacctgctggtcgagcaactcaatgaacaggcacgcctgaccccgcag
cgcaccgccctggtgtgggaaggcggcagcctggactacgccgagctgcaccagcaagcc
aaccggctggcccactacctgcgtgacaaaggcgtcggccccgacacctgcgtggcgatt
gccatcgagcgctcgccgcagttgctggtcggcctgctggccattctcaaggctggcggc
gcctacgtgccgctggatgtcgattacccggccgaacgcctggcctacatgctggccgac
tgcaacgccggcctgttgctgagccacagcagcctgctgggcaagctgccgcaggtcgcc
ggtgtcagcgccattgccctcgaccagttgcacctggacagctggcccagccaggccccc
ggcctgcacctgcacggcgacaacctggcctacgtgatctacacctccggctccaccggc
cagcccaagggcgtgggcaacacccacgcggcgctggccgagcgcttgcagtggatgcag
gctacctacgcgctgaacgacagcgacgtgctgatgcagaaagcgccgatcagcttcgat
gtgtcggtgtgggagtgcttctggccattgatcaccggctgcaagctggtgcttgccggg
ccgggcgaacatcgcgacccgcagcgcattgccgcactggtacaggcccaaggtgtgacc
acactgcacttcgtgccgccgctgttgcaggtgttcatccaggagccgcaggcgggcgcc
tgcagcagcctgcgccggttgttctcgggtggcgaagcgctgtccgccgctctgcgtgac
cgcgtgctgcaagtgctgccgcaggtgcaactgcacaaccgctatggcccgaccgaaact
gccatcaacgtcacccattggcactgccaggcggcggacggcgagcgctcgccgattggc
cgcccgctgggcaacgtgctatgccgcgtacttgacgacgagcttgaactgactgcgcca
ggcgtgccgggcgagctgtacctcggcggtgcgggcctggcccgtggctacctggggcgc
ccgggccttaccgccgagcgcttcgtgccccaggccgacggcaatggtcagcggctgtac
cgcagcggtgaccgcgcccgctggcaagttcagctagaggcgctggaatacctcggtcgc
cttgaccagcaggtaaaggtgcgtggcttccgtgtggagcccgaagaggttcaggcctgc
ctgctggcgcaagcgggagtcgaacaggcgctggtgctgattcacaagggcgctattggc
gcgcaactggtcggttattacagtggcagcgcccagcctgccgacttgctggccgtgctg
gctgagcaactgccagcctacatggtgccggcgcaactcatcgcgctggcgcagatgccg
ctgggccccagcggcaaggtcgagcgcaaggcactgccggccccggtctggcaacagcgc
gaacacgtcgagccacaaaccgagctgcagcaacaggtcgcggccatttggtgcgaagtg
ctgaatgtgccgcgcatcggcctgcaggacgacttcttcgccctcggcggccactcgttg
ctggccacccagatcgtttcgcgcacgcgccaggcctgcgatgtcgagctgccgctcaag
gccctgttcgacgccagcgagctgggcaccttctgtgccgagatcgcgcgcattcgcgcc
gccggtgaacgcaacctgcaaggcgacatcgcccgtgtcgaccgccgccaggcggtaccg
ctgtcgtactcgcagcagcgcatgtggttcctctggcaaatggagccggacagcccggcc
tacaacgtaggcggcatggctcgcttgcgcggcacgctgcatgtggacgccttcgagcgg
gcgctgcaggcgttgatcgtgcgccacgaaaccctgcgcaccaccttccccagcatcgat
ggtgtgccgtaccaatgcgtggccgaagacagtggcctgcacctcgactggcaagacttc
agcgccttgtcagccgatgcccgccagcaacgcttgcaacaactggccgacgatcaggcg
caccagccgttcgacctggagcgcggtccgctgctgcgcgcctgcttggtaaaagccgag
gaacgcgagcattacttcgtgctgaccctgcaccacatcgtcaccgaaggctgggccatg
gacatcttcgcccgcgagctgggcgagctgtacgaggccttcgtcgatgaccgtgagtcg
ccactggcgccgttgcctgtgcaatacctggactacagcgtctggcaacggcattggctg
gagagcggcgagggcgcccgccaactggcctactggaaggatcgcctgggcgacgagcac
ccggtgctggcgttgcccgctgaccgcccgcgcccggccgtgcagagccaccgtggcgag
ttgtaccgcttcgagctcgacccggcgttggtcgcccgtgtgcatgccttcaacagccag
cgcggcctgaccctgttcatgaccatgaccgctaccctggccgccttgttgcaccgctac
agcggccagcgtgacctgcgcatcggcgcaccgatggccaaccgcatccgcccggaaagc
gaaggcctgatcggcgccttcctcaacactcaggtgctgcgctgcgagctggacgggcag
atgaccgccagcgagctgctggagcagatgcgccaggccgccatcgaaggccagtcgcac
caggacctgccgttcgaccagttggtcgaggccctgcagccgccgcgcagcagcgcctac
aacccgctgttccaggtgatgtgcaacgtgcagcgctgggccttccagcaaagccgcacg
ctggccggcatgcaggtcgactacctggtcaacgatgccagtgccaccaagttcgacctg
tacctggaggtgaccgacctcgacggccgcctgggctgctgcctgacctacagccgtgac
ctgttcgacgagccgcgcattgcgcgtatggccgagcactggcagcaactgttggttggc
ctgctcgacaacccgcaacagcgcctgtgcgagctgccgatgctgagcagcgccgagcag
caggtgctggtcggccagttgcagggcgagcacgatttcgagctcgatcagaccctgcat
ggcctgttcgccgcccaggcggcgcgcacgccacaggccggtgccttgactttcgctggc
cagcacatgacctatgccgaactcgatcagcaggccaaccgcctggcccgcgccctgcgc
gagcgcggcgtcggcccgcaggtgcgtgtagggctggcgctggagcgttcgctggaaatg
gtcgtcggcctcctggccattctcaaggccggcggcgcttacgtgccgctcgaccccgag
tacccgctcgaccgcctgcgctacatgatcgaagacagccgcattggtttgctgatcagc
cagcgtgagctgttgaaaaccttgggtgagttgccgcaaggcgtcgcccgctggagcctg
gaagacgatgctgccagcctgtcggcctacagcgatgcgccgctggacaacctcaacctg
ccgcagcaccaggcttacctgatctacacctccggctccaccggcaagcccaagggcgtg
gtggtcagccacggcgaattcgccatgcactgccaggcggtgatcgccgcattcggcatg
cgcagcgatgattgcgagctgcatttttattcgatcaacttcgacgctgccagcgagcgc
ttgtgggtgccgctgctgtgtggtgcccgcgtggtgctgcgtgcccaggggcagtggggt
gccgaagacatctgccaactggtgcgtgagcaacaggtgagcatcctgggctttaccccc
agctacggcagccagttggcgcagtacctgggcgggcagggcgaacaactgccggtgcgc
ctggtgattaccggtggcgaagcactgaccggcgagcacctgcaacgtattcgccaggcc
tttgccccgcagcagttcttcaacgcctacggcccgaccgaaaccgtggtcatgccgttg
gcctgcctggcgccagaggcgttgccagcggaccttggcagcgtgccgatcggccgcgtc
atcggaagccgcacggcctacatcctcgacgaggacctggctttgttgccgcaaggtggt
attggcgagctgtatgtcggtggtgccgggctggctcagggctatcacgaccgccctggc
cttagtgccgagcgctttgtcgccgacccgttcagccccgcagggggccgcttgtatcgc
acgggcgacctggtgcggctgggcattgatggcctggtcgagtacgttgggcgtgccgac
cagcaggtgaaaattcgcggcttccgtatcgagctgggcgaaatcgagagccggctgcag
gcgcacttggatgtcgacgaggccgtggtactggccctggacttgccgggtggcaaacag
ctggtgggctatctggtgtgcaagcaggccagcgccggtagcgaggcgcagaacctgctg
cgcgaagccgtgaaagccgatgcccgccagcacctgccggactacatggtgcctgcgcac
ctggtgctgctcgacagcctgccactgatgggcaacggcaagctcgaccgccgtgcgctg
ccgctgccggacctggagcaggcgcgccagcagtaccaggccccaggcaacgaggtggaa
gcgcaactggcgcagatctggcgcgatgtactcaacgttgcccaggttggcgtgcaggac
aatttcttcgaactgggcggtgactcgatcctttcgattcaggtggtcagccgggcccgt
caggccggcttgcaattcaccccgcgcgacctgttccagcaccagaccatccagaccctg
gcggccgtggttcagcacagcgaagccgccagcagcatcgatcagggccagcgccagggc
cagaccggcctgacgccgattcagcactggttcttcgacagcgaagtgccacagccacag
cactggaaccaggcggtactgctggaggcacgccagccgctggacgaagccgcactggca
caagcgatggctgcgctggtgcagcaccatgacagcctgcgcctgcgtttcagcgaggcc
cagggcggctggcaggctcagtacgcgcagcctgctggcgaccagctgctgtggagcgcc
accgtggccgattttgcagactgccaggcgctgtacaccgaccttcagcgcagcctcgac
ctgcaacaaggcccgctgctgcgtggcttgctggtgcgtgacgggcagggcagccagcgc
ctgttgctggcgatccatcacctggtggtcgatggcgtgtcctggcgggtgttgctggaa
gacttgcaggcgctgtaccgtggccagccactgccgaccaagactcacgccatgggcgat
tgggccgcacgcctggccagttacgccggcagcgattcgctgcgcgacgaactgggctgg
tggcaaggccagctgggtggcgtgcgccgcgaactaccgtgcgatcacccgcagggtggc
aacttgcaccgccacgcccataccctggccatcggcctggacgtggagcaaacccggcaa
ctgctgcaacaggccccggcggcctaccacacccaggtcaatgacctgctgctcactgcg
ctggcgcgtgccttgtgccgctggagtggcgaggaagaagtgctggtgcagctcgaaggc
cacggtcgtgacgggttgttcgaggacatggacctgacccgcagtgtcggctggttcacc
aacgcctatccactgagcctgcgcccgttgccaggcgaggacgacgcggcgcgggccggc
tcgatcaaacgcatcaaggagcaactgcgccaggtgccgcacaaggggcttggctacggt
gtactgcgctacctggccgatgcggccgggcgcgagcagatggcggccttgccgcaggcg
cgtatcaccttcaactacctgggtcagttcgaccagcagttcgacagcaccgcgctgttc
cagccactggaggccccagcaggcctggctcacgacctcgacgcaccgctgcccaactgg
ctgagcgtcgatggccaggtgtatggcggcgccctgcaaatgcgctggacctacagcgcc
gagcgctatgaccagcaaaccattgcccggctggccgaggcctatcgtcaggagttgctg
acgctggtcgcgcattgcctggccgatggcaacggcagtttcaccccctcggacttcccg
ttggcgcatctgacgcaggcgcagatcgacgccctgccggtaccggctgcgcagatcgag
gacgtctacccgctgacgccgatgcaggaaggcatgctgctgcacaccctgctggagccg
ggcaccggcctttactacatgcaggaccgctaccgcatcaacagcgccctggaccctgag
cgtttcgcccaggcctggcaggccgtggtggcgcgccatgaagcattgcgcgcttcgttc
agctggaacagcggcgaggcgatgctgcagatcatccacaaaccgggcaacctggcggtg
gactaccaggactggcgcggccttgcagacgacgcccaggagcagcgcctgcaggccctg
cacaagcaagagcgcgaggccggttttgccctgctcagcgaagcaccgttccacctgcgc
ctggtgcgcgtggccgacgagcgctattggttcatgatgagcaaccaccacatcctgatc
gatgcctggtgccgctcgctgctgatgaacgacttcttcgaggtctaccaggcccttggc
gaaggccgtcaggcccaactgccggtgccgccgcgctaccgcgactacatcggctggctg
caacgccagggcctggacgacgcacgcgcctggtggcaggccaacctggccggcttcgag
cgcgccacggctatcccaagtgaccgcccgctgcgccatgaccacgcgggtagcggcatg
gtggtcggcgattgctacacccgcctggaggtgagcgatggcgtgcgcctgcgtgaactg
gcccaggctcaccagctgaccgtcaacaccttcgcccaggcggcctgggccctggtgctg
gcgcgttacagcggtgaccgcgacgtggcctttggcgtaaccgtggccgggcgcccggtg
agcatgccgcagatgcagcgcaccgtcgggctgttcatcaacagcgttgccctgcgcgtg
cagttgccggtagccggtgagcgccgcagcgtgcgccagtggctgcaaggcctgctgcaa
agcaacatggaactgcgcgagtacgaatacctgccgttggtggcgatccaggagtgcagc
gagctgcccaagggccagccgctgttcgacagcctgttcgtgttcgagaacgccccggtg
gaaaccgccgtgctcgaccacgcccagcacctgaatgccagctccgactcgggccgtacc
cacaccaacttcccgttgacggcggtgtgctaccccggcgacgacctgggcctgcacctg
tcgttcgaccagcgctacttcgactacccgaccgtcgagcgcctgctggccgagttcaag
cgcatgctgttggcgctggtacaaggcttcgagggcgaggtgagcgagctgccgatgctg
ggggcagacgagcagcgcttcctgctggaagactgcaaccgcaccgagcgggcttatccg
ctggaacagagctatatcgcacagttcgaagcgcaagtggctgcgcacccggaacgtacc
gtggcccgctgcctggaggcgtcctacgactacgccgggctgaacctggcggctaaccgc
ctgggccatgccttgatctgggccggtgtgaaggtggaccagccggtggcactgctggcc
gagcgcgggttgccgctgctgggcatgatagtcggcagcttcaaggccggtgccggctac
ttgccgctggacccgggcctgcctgccgcgcgcctgcaaagcatcatccagctcagccgt
accccggtgctggtatgcagcgcggcctgtgccgagcaaggccggcagttgctggctgag
ctgaacgttgcgccaaggccacagctgctggtgtgggaagacatccaggccagccaggtt
gccagccacaacccaggcatccacagtggcccggacaaccttgcctatgtgatctacacc
tcaggctccaccggcctgccgaaaggggtgatggtcgagcagcgtggcatgctcaacaac
cagctgagcaaggtgccgtacctggcattgagcgagcaggacgtggtcgcccagactgcc
tcgcagagcttcgacatttcggtgtggcagttccttgccgcgccgctgttcggggccaag
gtggagatcgtgccgaacgccatcgcccatgacccacaggggctgctggcgcacgtgcag
gccaccggcattaccgtgctggaaagcgtgccgtcgctgatccagggcatgttggccagc
gaccaccaggcgctggacggcctgcgttggatgctgccgaccggcgaggcgatgcccccg
gagctggccgcgcagtggctgcagcgctacccgcagatcggcctggtcaacgcctacggc
ccggcggagtgctcggatgacgtggcgttcttccgtgtcgatgccgcgtcgacccaaggc
agttacctgcccatcggcacgccgaccgacaacaaccgcctgtacctgtttggtgaagac
caggcgctggtgccgctgggtgcggtgggcgaactgtgtgtggctggcacgggcgttggc
cgtggctatgtcggcgacccgctgcgtactgcgttggcgtttatccctcacccatacggt
gcaccgggcgagcgcctgtaccgcaccggtgacctggcgcggcagcgcccggacggtgtg
ctggagtacgtcgggcgcatcgaccatcaggtgaagatacgcggctaccgcatcgagctg
ggcgagatcgaagcccgcctgcacgaacaggcggaaatccgcgatgctgcggtgggcgtg
caggagggcgtcaatggcaagcatctggtcggttacctggtggcccatcagggcatcgct
gccgacgccgcgttgctggaacaggtgaagcaacgcctgcgtgccgagttgccggagtac
atggtaccgctgcactggagctggttcgacagcctgccgcacaacgccaacggcaagctg
gaccgcaaggcgctgcccgccatcgacattggcggccagcacagccaggcctaccaggcg
ccgcgcaatgagctggaagaggtcttggcgggtatctgggccgatgtgctcaaggccgag
cgggtgggggtgcacgacaacttcttcgagctgggcgggcattcgttgctggccacgcag
attgcctcgcgggtgcagaagcaattgcagttgaacgtaccgttgcgggcgatgttcgag
tgcagcactgtggaggaactggccgagtacgtgcagggcctgcagggcagtgcgctggat
gacgacaaggtcgaccggttgagtgatctgatggccgagttggaaggcctttga

DBGET integrated database retrieval system