KEGG   Pseudoalteromonas phenolica: PP2015_2223Help
Entry
PP2015_2223       CDS       T04165                                 

Definition
(GenBank) Alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
pphe  Pseudoalteromonas phenolica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pphe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PP2015_2223
Enzymes [BR:pphe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PP2015_2223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:2570260..2571681
Genome map
AA seq 473 aa AA seqDB search
MTTHIKSNKQLKIAALLLGAVSFQSSADVILHAFNWRYDDVASKAQEIAELGYKKVLVSP
AYKSTGDAWWSRYQPQDLRVIDNPLGDTNDFKAMVQALKAQGVETYADIVFNHMANEQWK
RADLNYPGSEILADYAADINYYNDITLFGDVKDGLFGAGDFHGTYDQGGPKCISNYNDVG
DVQYNRLCGAAPDPGLPDLDPNNWVITQQKAYLNALKQIGVTGFRVDAAKHMTNYHINAV
FDANIKKDTHVFGEIITTGGSGSGDYDNFLVPYLAQTGHSAYDFPLFAQIRGAFSFGGSM
SQLVDPAAYGQALAGNKAITFSVTHDIPLNDGFRYQIMDATDEKLANAYVLGRDGGVPLV
YSDNNESGDNRWNDLYRREDIKGMLKFHNATQGSSMQVLSHNSCILLFKREHKGVVGINK
CGTGQDIWVDTQADNLWWHRNYRDTLSNDVQNISSQWHKFYLPARTARMWLME
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacatataaaatcaaataaacaacttaaaattgcagcgcttttacttggtgct
gttagcttccaaagcagcgcagatgttattttacatgcatttaactggcgctatgatgac
gttgcgagcaaggctcaagagattgcagaacttgggtataaaaaagtactcgtctctccc
gcttataaatcgactggagatgcatggtggtctcgttatcagccacaggatcttcgtgtc
attgataatccattgggcgataccaatgattttaaggccatggtgcaagcgcttaaagcg
caaggtgtagagacatatgccgacatagtttttaatcatatggcaaacgagcaatggaaa
cgcgctgatcttaactatccaggaagcgaaattttagccgactacgccgctgatattaac
tattacaacgacattacactattcggtgatgttaaagatggtttattcggcgcgggtgat
tttcacggtacatacgaccaaggtggtccaaaatgcatcagtaattacaatgacgttggc
gatgtacaatacaaccgactatgtggcgctgcccccgatcctggcctccccgatttagac
cctaacaattgggttatcactcaacaaaaagcgtatttaaatgcgttaaaacaaattggc
gtaacgggctttagagttgatgccgcaaaacatatgaccaactaccatattaatgccgtg
tttgatgccaacattaaaaaagatacgcatgtatttggtgaaattataacgacaggtggt
tcaggtagcggtgattacgataactttttagtgccttacttggcacaaacaggccactca
gcttatgactttcccctgtttgcacagatcagaggcgcatttagttttggcggttcaatg
agtcaacttgttgaccctgcagcctatggccaagcattggccggtaacaaagccattacg
tttagcgttactcatgatatcccattgaatgatggctttagatatcaaattatggatgcc
accgatgaaaaacttgcgaacgcatatgttttgggcagagatggtggtgtaccacttgtg
tattcggataataacgaaagtggtgataaccgctggaatgatctctatcgtcgtgaagac
attaaaggcatgcttaaattccacaatgccacccaaggcagtagcatgcaggtgctaagc
cacaatagctgtattttattattcaaacgcgagcacaaaggcgtggttggtatcaataag
tgtggcactggccaagatatctgggtagatacgcaagccgataatttatggtggcaccgt
aactaccgagatacattaagcaacgatgtgcaaaatatttcgagtcagtggcataagttt
tacctaccagcgcgaacagcaagaatgtggttgatggaataa

DBGET integrated database retrieval system