KEGG   Pseudomonas putida ND6: YSA_02108Help
Entry
YSA_02108         CDS       T02170                                 

Definition
(GenBank) glutathione S-transferase domain-containing protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
ppi  Pseudomonas putida ND6
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    YSA_02108
Enzymes [BR:ppi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     YSA_02108
Transporters [BR:ppi02000]
 Other Transporters
  Pores ion channels [TC:1]
   YSA_02108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1126845..1127447)
Genome map
AA seq 200 aa AA seqDB search
MYKVYGDYQSGNCYKVKLMLSLLGRPYEWHPVDILKGETETPEFLAMNPNGKVPVLELED
GSYLWESNAILNFLADGSEFLPSEPRLRTQVLQWQFFEQYSHEPYIAVARFIQFYLGLPD
ERLDEYRKLHKGGYKALKVMERQLQMTPYLVGEHYSIADVALYAYTHVAQQGGFDLAEYP
AVRAWLERVSSHPRHVPMVG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaggtctatggcgactaccagtcgggtaactgttacaaggtcaagctcatgttg
agcctgctgggccggccctatgaatggcacccggtggacatcctcaagggcgagaccgaa
acgcccgagtttctggcgatgaaccctaacggcaaggtaccggtgctggaactggaagac
ggtagctacctgtgggagtccaacgccattctcaacttcctggccgatggcagcgagttc
ctgcccagcgagccgcgcctgcgtactcaggtgctgcagtggcagtttttcgagcagtac
agccatgagccgtacattgccgtggcgcggttcatccagttctacctggggttaccggac
gagcgcctggacgagtaccgcaaattgcacaagggcggctacaaggcgctgaaggtgatg
gagcgtcagttgcagatgacgccttacctggtgggtgagcactactcgattgccgatgtg
gcgttgtatgcctacacccatgtggcgcagcagggcggcttcgacctggcggagtacccg
gcggtaagggcctggctggagcgggtcagcagccacccgcggcatgtgccgatggtgggt
tga

DBGET integrated database retrieval system