KEGG   Pseudomonas putida ND6: YSA_05907Help
Entry
YSA_05907         CDS       T02170                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ppi  Pseudomonas putida ND6
Brite
Translation factors [BR:ppi03012]
 Eukaryotic Type
  Elongation factors
   YSA_05907
 Prokaryotic Type
   YSA_05907
Mitochondrial biogenesis [BR:ppi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    YSA_05907
Exosome [BR:ppi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YSA_05907
  Exosomal proteins of breast cancer cells
   YSA_05907
  Exosomal proteins of colorectal cancer cells
   YSA_05907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: AFK69960
UniProt: I3UWV2
LinkDB All DBs
Structure
PDB: 

Jmol
Position
3200707..3201900
Genome map
AA seq 397 aa AA seqDB search
MAKEKFDRSLPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSAIVEFDKIDSAPEEKARG
ITINTAHVEYNSTIRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADLVDDAELLELVEMEVRDLLSTYDFPGDDTPIIIGSARMALE
GKDDNEMGTTAVKKLVETLDSYIPEPVRAIDQPFLMPIEDVFSISGRGTVVTGRIERGIV
RVQDPLEIVGLRDTTTTTCTGVEMFRKLLDEGRAGENCGVLLRGTKRDDVERGQVLVKPG
SVKPHTKFTAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNCELPEGVEMVMPGDNI
QMTVTLIKTIAMEDGLRFAIREGGRTVGAGVVAKIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggaaaagtttgatcgttcccttccccacgttaacgtcggcactatcggccac
gttgaccacggtaagaccactctgaccgcagctctgactcgcgtttgctccgaagttttc
ggttcggcaatcgttgagttcgacaagatcgactcggctccggaagaaaaagcgcgcggt
atcaccatcaacaccgctcacgttgagtacaactcgaccattcgtcactacgctcacgtt
gactgcccaggtcacgctgactacgtgaagaacatgatcaccggtgctgcccagatggac
ggcgcgatcctggtttgctcggccgccgatggtccgatgccacaaacccgtgagcacatc
ctgctgtcccgtcaggtaggcgttccgtacatcgtggtcttcctgaacaaggctgacctg
gtagacgacgctgagctgctggaactggtcgagatggaagttcgcgacctgctgtccacc
tatgacttcccaggcgacgacaccccgatcatcatcggttcggctcgtatggcgctggaa
ggcaaagacgacaacgaaatgggcactaccgctgttaagaagctggtagaaactctggac
agctacattcctgagccagttcgtgctatcgaccagccgttcctgatgccgatcgaagac
gtattctcgatctcgggtcgtggtaccgttgttaccggtcgtatcgagcgtggtatcgtc
cgcgttcaggatccgctggaaatcgttggtctgcgtgacaccaccaccaccacctgcacc
ggtgttgagatgttccgcaagctgctggacgaaggtcgtgctggcgagaactgcggcgtt
ctgctgcgtggcaccaagcgtgacgacgttgagcgtggtcaggttctggtcaagccaggt
tcggtcaagccgcacaccaagttcaccgcagaagtctacgtcctgtcgaaggaagaaggc
ggccgtcacactccgttcttcaaaggctaccgtccacagttctacttccgtaccactgac
gtgaccggtaactgcgaactgccggaaggcgttgaaatggtaatgccaggtgacaacatt
cagatgactgttaccctgatcaagaccatcgcaatggaagacggtctgcgcttcgctatc
cgtgaaggcggtcgtaccgtcggcgccggtgtcgtagcaaaaattattgaataa

DBGET integrated database retrieval system