KEGG   Pseudomonas putida ND6: YSA_08352Help
Entry
YSA_08352         CDS       T02170                                 

Definition
(GenBank) peptide synthase
Organism
ppi  Pseudomonas putida ND6
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4495583..4508536
Genome map
AA seq 4317 aa AA seqDB search
MTDAFELPLSLVQALAQRAAQTPDRIALRFLADTPGEQAVLSYRDLDQRARTIAAALQAR
ASFGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESARQHHQARLLSIIADAEPRLL
LTVAALHDNLNGLEALAADNAPELLAVDGLDPLLASSWHAPELQRDDIAFLQYTSGSTAL
PKGVQVSHGNLVANEQLIRQGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVL
MSPGYFLARPLRWLQAISEYGGTISGGPDFAYRLCSERVSEASLAGLDLSRWRVAYSGSE
PIRQDSLATFADKFQACGFDPQSFFASYGLAEATLFVSGSRRGQGIAALELDAEAFAGNR
AEPGKGSVLMSCGYPQPGHAVRIVEPQRLQVLDDNQVGEIWAGGPSIALGYWRNPEASAR
TFVEMDGQTWLRTGDLGFMREGEVFVTGRLKDMLIVRGQNLYPQDLEKNLEREVQVLRKG
RVAVFAVEHQGEEGIGVAVEISRNVQKALKPQDLIKTLRQVIADACRQAPAVVLLLNPGA
LPKTSSGKLQRSACRLRMDDGSLDCYARFPEVSEAGTRATAGDELQARIAAVWRDILKVE
AVAADDHFLLLGGNSIAATQATARLADELGIDMSLRTLFEAPVLADYSKAVAQIIADGAA
GTAAITTLARAQALPQSLAQSRLWLLWQLEPQSAAYNIPAGLHLRGELDVNALHVAFEAL
VARHESLRTVFSEENGQALQRILPQQPLSLHRLDLEGHSPDQVAAQRETEARQPFDLTQG
PLLRVTLVRLGDEEHQLWVTLHHIVADGWSLNILLEEFAKLYAARCQGLEANLAPLPLGY
ADYGSWQRQWLADGEAERQLQYWKAHLGGELPALDLCTDHPRASQREHSAARFSLKVPAR
LGEALKGLAHQQQASLFMVLLAGWQALLQRYSGQADIRVGVPNANRPRLETQGMVGFFIN
TQVLRARFDGRHSFTQLLTQVRQATLQAQANQDLPFEQLVEALPDAREQGLFQVMFNHQQ
RDLSALRRLPGLLAEELAWHSREAKFDLQLHSEEDHLGRLSLAFDYAAELFEASTVERLA
HHLLALLEQVCAAPQQALGDVQLLDEPGRAQLLGWGQAPAAAARHLLVEQLNEQARLTPQ
RTALVWDGGSLDYAGLHQQANRLAHYLRDKGVGPDTCVAIAIERSPQLLVGLLAILKAGG
AYVPLDVDYPAERLAYMLADCDARLLLSHSSLLGKLPQVDGVSAIALDQLHLDSWPSHAP
GLHLHGDNLAYVIYTSGSTGQPKGVGNTHAALAERLQWMQTTYALNDSDVLMQKAPISFD
VSVWECFWPLVTGCKLVLAGPGEHRDPQRIAALVQAYGVTTLHFVPPLLQVFVQEPQAGA
CSSLRRVFSGGEALSAALRDRVLQVLPQVQLHNRYGPTETAINVTHWHCQVADGERSPIG
RPLGNVLCRVLDDELELSAPGVPGELYLGGAGLARGYLGRPGLTAERFVPQADGNGQRLY
RSGDRARWQVQLEALEYLGRLDQQVKVRGFRVEPEEVQACLLAQGGVEQALVLIHKDAVG
AQLVGYYSGSAQPAEVLAVLAEQLPAYMVPAQLIPLAQMPLGPSGKVDRKALPAPVWQQR
EHVEPRTELQQQVAAIWRDVLNLPRIGLQDDFFALGGHSLLATQIVSRTRQACDVELPLK
ALFEASELGAFCAEIARLRAAGERNLQGAIARVDRCQAVPLSYSQQRMWFLWQMEPDSPA
YNVGGMARLRGTLHVDAFERALQALVVRHETLRTTFPSIDGVPYQCVAEDSGLHLDWQDF
SALSDDACQQRLQQLADDQAHQPFDLERGPLLRACLVKANEREHFFVLTLHHIVTEGWAM
DIFARELGELYEAFVDDRESPLAPLPVQYLDYSVWQRQWLESGEGARQLAYWKHRLGDEH
PVLALPADRPRPAVQSHRGALYRFELDPALVDRVHAFNSQRGLTLFMTMTATLAALLHRY
SGQRDLRIGAPVANRIRPESEGLIGAFLNTQVLRCELDGQMTASELLEQLRQVAIEGQSH
QDLPFDQLVEALQPPRSSAYNPLFQVMCNVQRWAFQQSRTLAGMQVDYLVNDASATKFDL
YLEVTDLDGRLGCCLTYSRDLFDAPRIARMAEHWQQLLVGLLDNPHHRLCELPMLSSAEQ
QVLTGQLQGEHDFDLGQTLHGLFAAQAARTPQAGALTFAGQHLTYAELDQQANRLARALR
ERGVGPQVRVGLALERSLEMVVGLLAILKAGGAYVPLDPEYPLDRLRYMIEDSRIGLLLS
QRALLHTLGELPEGVASWSLEDDAASLAAYSDAPLDNLSLPQHQAYLIYTSGSTGKPKGV
VVSHGEFAMHCQAVIAAFGMRSDDCELHFYSINFDAASERLWVPLLCGARVVLRAQGQWG
AEDICQLVREQQVSILGFTPSYGSQLAQYLGGRGEQLPVRLVITGGEALTGEHLQRIRQA
FAPQQCFNAYGPTETVVMPLACLAPEALPADLGSVPIGRVIGSRTAYILDEDLALLPQGG
IGELYVGGAGLAQGYHDRPGLTAERFVADPFSAEGGRLYRTGDLVRLGIDGLVEYVGRAD
QQVKIRGFRIELGEIESRLQAHEAVDEAVVLALDLPGGKQLVGYLVCRQATAGNDVQQLL
REAVKADARQHLPDYMVPAHLVLIDSLPLMGNGKLDRRALPLPDLEQTRQQYQAPGNEVE
AQLAQIWREVLNVARVGVQDNFFELGGDSILSIQVVSRARQAGLQFTPRDLFQHQTIQTL
ATVVQLSEAASTVEQGLRQGQAGLTPIQHWFFDSDVPQPQHWNQAVLLEVRQPLVEATLE
QALAALVQHHDSLRLRFSDAQGRWQAQYAQPGAEQLLWSATVADFNDCQALYTDVQRSLD
LQQGPLLRALLVRDGQGTQRLLLAIHHLVVDGVSWRVLLEDLQALYRGQPLPAKTHAVGD
WAARLASYAGSDSLRDELAWWQGQLGGVRRELPCDHPQGGNLHRHAQTLAIGLDVEQTRQ
LLQLAPAAYHTQVNDLLLTALARALCRWSGDEEVLVQLEGHGRDGLFEDMDLTRSVGWFT
NAYPLSLRPLPGEDDAARAGSIKRIKEQLRHVPHKGLGYGVLRYLADAAGREQMAALPQA
RITFNYLGQFDQQFDSAALFQPLEAPAGLAHDLDAPLPNWLSVDGQVYGGALQLRWTFSA
ERYDQQTIAGLAEGYRQELLALVAHCLADGNGSFTPSDFPLAHLTQEQIDALPVPAAQIE
DVYPLTPMQEGMLLHTLLEPGTGLYYMQDRYRINSALDPERFAQAWQAVVARHEALRASF
SWNSGEAMLQIIHKPGNLAMDYQDWRGLADDAQEQRLQALHKQEREAGFALLSEAPFHLR
LVRVADERYWFMMSNHHILIDAWCRSLLMNDFFEVYQALGEGRQAQLPVPPRYRDYIGWL
QRQGLDDARAWWQANLAGFERATAIPSDRPLRHDHAGSGMVVGDCYTRLEVNDGVRLREL
AQAHQLTVNTFAQAAWALVLSRYSGDRDVAFGVTVAGRPVSMPQMQRTVGLFINSVALRV
QLPAAGERCSVRQWLQGLLQSNMELREYEYLPLVAIQACSELPKGQPLFDSLFVFENAPV
ETAVLDHAQHLNASSDSGRTHTNFPLTAVCYPGDDLGLHLSFDQRYFDYPTVERLLAEFK
RLLLALVQGFEGEVSELPLLSAQEQGFLLEDCNRTERVYPLEQSYIAQFEAQVVAHPQRT
VARCLEASYDYAGLNLAANRLGHTLVAAGVCVDQPVALLAERGLPLLGMIVGSFKAGAGY
LPLDPGLPAARLQSIIQLSRTPVLVCSAACAEQGRQLLGELEAALRPQLLVWEDVQANPI
ASHNPGIHSGPDNLAYVIYTSGSTGLPKGVMVEQRGMLNNQLSKVPYLALSEQDVIAQTA
SQSFDISVWQFLAAPLFGAKVEIVPNAIAHDPQGLLAHVQTTGITVLESVPSLIQGMLAS
DRQALDGLRWMLPTGEAMPPELAAQWLQRYPQIGLVNAYGPAECSDDVAFFRVDAASTQG
SYLPIGTPTDNNRLYLFGEDQALVPLGAVGELCVAGAGVGRGYVGDPVRTALAFIPHPYG
APGERLYRTGDLARQRLDGVLEYVGRIDHQVKIRGYRIELGEIEARLHEQAEIRDAAVAV
QEGVNGKHLVGYLVAHQGVSADAALLEQVKQRLRAELPEYMVPLHWGWFDSLPHNANGKL
DRKALPAIDIGGQYSQAYLAPRNELEDVLAVIWADVLKAERVGVHDNFFELGGHSLLATQ
IASRVQKQLQLNVPLRAMFECSTVEALAEYVQGLQGSALDDDKVDRLSDLMAELEGL
NT seq 12954 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgccttcgaactcccgctctcgctggtccaggccctggcgcaacgcgccgcg
cagaccccggacaggattgccctgcgctttctcgccgacacccccggcgagcaggccgtg
ctcagctaccgggacctcgaccagcgtgcacgcaccatcgccgctgccttgcaggcgcgc
gccagcttcggtgaccgtgccgtgttgctgtttcctagcgggccagactacgtggcggcg
ttttttggctgcctgtatgcgggcgtgatcgcagtgccggcttacccgccggagtccgcg
cggcagcatcaccaggcgcgtttgctgtcgatcatcgccgatgccgagccgcgcctgctg
ctgaccgtggcggcactgcacgacaacctgaacggcctggaggcactggcggcagataac
gcgcccgagctgcttgccgtggatggcctggacccgttgctggcctcgagctggcacgcc
cccgagctccaacgcgatgacatcgccttcctgcagtacacctccggctccaccgcgctg
cccaagggggtgcaggtcagccatggcaacctggtggccaacgagcagctgatccgccaa
ggctttggcatcgacctcaaccccgacgatgtgatcgtcagctggctaccgctgtaccat
gacatgggcctgatcggcggcctgctgcagccaatcttcagtggcgtgccttgcgtgctg
atgtcgccggggtacttcctggcccggccgttgcgctggttgcaggccatcagcgaatac
ggtggcaccatcagcggtggccccgacttcgcttatcgcctgtgcagcgagcgggtcagc
gaggcttcgctggccgggctcgacctgagccgctggcgcgtggcctattctggctccgag
ccgatccgccaggacagcctggccacctttgccgacaagttccaggcctgcggcttcgac
ccacagagcttctttgccagttatggcctggccgaagccaccctgttcgtcagcggcagc
cgtcgtggtcagggcatcgctgcactggagctggacgccgaagccttcgctggcaaccgc
gccgagccaggcaaaggcagcgtgctgatgagctgtggctacccacagccggggcatgcc
gtacgcatcgtcgaaccacaacgcctgcaagtgctggatgacaaccaggttggcgagatc
tgggccggcggcccgagcatcgcattgggttactggcgcaaccccgaagccagcgctcga
acattcgtcgaaatggacggccagacctggctgcgtaccggcgacctgggtttcatgcgt
gagggcgaggtgttcgttaccgggcgcctgaaagacatgctgatcgtgcgcggacagaac
ctgtacccacaagacctggagaaaaacctcgagcgcgaagttcaggtgctgcgcaaaggc
cgtgtggcggtgttcgccgtcgagcaccaaggcgaggagggcatcggtgtcgcggtggag
atcagccgcaacgtgcaaaaggcactcaagccccaggacctgatcaagaccctgcgccag
gtcatcgccgacgcctgccgacaggccccggccgtggttctgctgctgaaccccggcgcg
ctgccgaagacctccagcggcaagttgcagcgctctgcctgccgcctgcgcatggacgat
ggcagcctggactgctatgcccgtttccctgaggtgagcgaagccggtacccgtgcaacc
gctggcgatgagctacaagcacgcatcgccgctgtgtggcgcgacatcctcaaggtagag
gcggtggccgcggacgaccacttcctgctgctgggcggtaactccatcgccgccactcag
gccacagcgcgcctggccgatgagttgggtatcgacatgagcctgcgtaccctgttcgag
gcgccggtactggccgactacagcaaggctgtggcacagatcatcgccgatggcgccgca
ggcaccgcagcgatcaccacgctggcgcgcgcccaggcattgccccagtcgctggcgcaa
agccgcttgtggctgctgtggcagctggaaccgcaatcagcggcctacaacattcctgcc
ggcttgcacctgcgtggcgagctggatgtcaacgctctgcacgtggccttcgaggcactg
gtggcgcgccatgaatcgctgcgtaccgtgttcagcgaagagaatggccaggcgctgcag
cgtatcctgccgcagcagccgctcagcctgcaccgtctggaccttgaagggcactcgccc
gatcaggttgccgcgcagcgtgaaaccgaggcccgccagccgttcgacctcacccagggg
ccgctgttgcgggtaaccctggtgcgcctgggcgacgaagagcatcagctgtgggtgacc
ctgcaccacatcgttgccgacggctggtcgctgaacatcctgctcgaagaattcgccaag
ctgtatgccgctcgctgccaaggcctggaggccaacctggcgccgctgccgctgggttac
gccgactacggcagctggcagcggcaatggctggctgacggtgaagccgagcgccagttg
cagtactggaaggcacaccttggtggtgagctgccggcgctcgacctgtgcactgaccac
ccgcgcgccagccagcgcgaacacagcgccgcgcgcttcagcctcaaggtgccagccagg
cttggcgaagcgctcaagggccttgcccaccagcagcaggccagcctgttcatggtcctg
ctggccggttggcaggcgctgctgcagcgctacagtggccaggccgatatccgcgtcggc
gtgcccaacgccaaccgcccgcgcctggaaacccaaggcatggtcggtttcttcatcaat
acgcaggtgctgcgcgcgcgattcgatggccgtcactcgtttacccagttgctgacccag
gtacgtcaggccaccttgcaagcccaggctaatcaggacctgcccttcgaacagcttgtc
gaagccctgcccgatgcgcgcgagcagggcctgttccaggtcatgttcaaccaccagcaa
cgcgacctgtcagccctgcggcgcctgccagggctgttggccgaagagctggcgtggcac
agccgcgaagccaagttcgacttgcagttgcacagtgaggaggaccatctgggccgcctg
agcctggccttcgactatgccgcggagctgttcgaagccagcaccgtcgaacgtctggcc
catcacctgctggcgttgctggaacaggtgtgtgccgcgccgcagcaggcgctgggcgac
gtgcaactgctggatgagcccggccgtgcgcagctgctgggttggggccaggcaccggcc
gccgcagcgcggcacctgttggtcgaacaactcaatgagcaggcacgcctaacgccgcaa
cgcaccgccctggtttgggacgggggcagcctggattacgccgggctgcaccagcaagcc
aaccgcctggcccactacttgcgcgacaaaggcgtcggccccgatacctgtgtggccatt
gccatcgagcgctcaccgcaattgctggtcggcctgctagccattctcaaggctggcggt
gcctacgtgccgctggatgtcgattaccctgccgaacgcctggcctacatgctggccgac
tgcgacgcccgtttgctactgagccacagcagcctgctgggcaagctgccgcaggtcgac
ggtgtcagcgccattgccctcgaccagttgcacctggacagctggcccagccatgccccc
ggcctgcacctgcacggcgacaacctggcctacgttatctatacctccggctccaccggg
cagcccaagggcgtaggcaatacccatgcggcgctggccgagcgcctgcagtggatgcag
acgacctatgcgctgaatgacagcgacgtgctgatgcagaaggcgccgatcagtttcgac
gtctcggtgtgggaatgcttctggccgttggtcaccggctgcaagctggtgctcgccggc
cccggtgaacaccgcgacccacagcgtatcgctgccctggtgcaggcttatggggtgact
acgctgcactttgtaccgccgctgttgcaggtgttcgtccaggagccgcaggcaggtgcc
tgcagtagcttgcgccgggtgttctcgggtggtgaagcgttgtccgccgcgctgcgtgac
cgcgtgctgcaggtgctgccgcaggtgcagctgcacaaccggtacggcccgaccgaaacc
gccatcaacgtcacccactggcactgccaggtggcggacggcgagcgctcgcccatcggc
cgcccgctgggcaatgtgctgtgccgcgtgctggacgatgagctggaactgagcgccccc
ggtgtgccgggcgagctgtacctcggtggcgcgggcctggcccgtggttacctgggccgc
cccggcctcactgccgagcgcttcgtaccgcaggccgacggcaatggtcagcgtctgtac
cgcagtggcgatcgcgcccgctggcaggttcagctggaggcactggaataccttggccgc
ctcgaccagcaggtcaaggtgcgtggtttccgcgtcgagcccgaggaagtacaggcctgc
ctgctggcacaggggggtgtggaacaggcgctggtgctgatacacaaggacgccgttggc
gcgcaactggtcggctattacagtggcagcgcccagcctgccgaggtgctggccgtgctg
gctgagcaattgccagcctacatggtgccggcgcaactcatccccttggcacagatgcca
ctgggccccagcggcaaggtcgaccgcaaggcactgcctgccccagtgtggcagcagcgt
gagcatgtcgagccacgaaccgagctgcaacaacaagtcgcagccatctggcgcgacgtg
ttgaatctgccacgcattggcctgcaggacgacttcttcgccctcggtggccactcgttg
ctggcgactcagatcgtttcgcgcacccgccaggcctgcgatgtcgagctgccgctcaag
gccctgttcgaagccagcgagctgggcgccttctgtgccgagatcgcccgcctgcgcgcg
gccggcgagcgcaatctgcaaggtgcaatcgcccgtgtcgaccgctgtcaggcggtgccg
ctgtcgtactcgcagcagcgaatgtggttcctctggcagatggagccggacagcccggcg
tacaacgtcggcggcatggcacgcctgcgcggcaccctgcatgtggacgccttcgagcgt
gcgctgcaggcgctggtcgtgcgccacgaaaccttgcgcaccacgttccccagcatcgac
ggcgtgccgtaccagtgcgtggccgaagacagcggcctgcatctggactggcaagacttc
agcgctttgtcagacgatgcctgccagcaacgtttgcaacaactggccgacgaccaggcg
caccagcccttcgacctggagcggggtccgctgctgcgcgcctgcctggtcaaggcaaac
gagcgcgagcacttcttcgtgctgacgctgcaccacatcgtcaccgaaggctgggccatg
gacatcttcgcccgcgagctgggcgagctgtacgaagcctttgtcgatgaccgcgaatcg
ccactggcgccgctgccggtgcagtacctggactacagcgtgtggcaacggcaatggctg
gaaagcggcgagggcgctcgtcaactggcctactggaagcaccgcctgggcgacgagcac
ccggtgctggcgttgcctgccgaccgcccgcgtccggcagtccagagccaccgtggcgcg
ctgtaccgcttcgaactcgatccggcactggtggaccgcgtgcatgctttcaatagccag
cgcggcctgaccctgttcatgaccatgaccgccaccctggccgccttgctgcaccgttac
agtggccagcgcgacctgcgtatcggcgcgccggtggccaaccgcatccgcccggagagc
gaaggcctgatcggtgccttcctcaacacccaggtgctgcgttgcgagctggacgggcag
atgaccgccagtgaactgctggagcagctgcgtcaggttgccatcgaaggccagtcgcac
caggacctgccgttcgaccaactggtagaggccctgcagccaccgcgcagcagtgcctac
aacccgttgttccaggtgatgtgcaacgtgcagcgctgggccttccagcaaagccgcacg
ctggccggcatgcaggtggactacctggtcaacgatgccagcgccaccaagttcgacctg
tacctggaggtgaccgacctggacggccggctgggctgctgcctgacctacagccgtgac
ctgttcgacgcgccgcgcatcgcgcgcatggccgagcactggcaacaactgctggtcggt
ttgctcgacaacccgcaccaccgcctgtgcgaactgccgatgctgagcagtgccgagcaa
caagtgcttacgggccaattgcagggcgaacacgatttcgaccttggccagaccctccac
ggtctgttcgccgcccaggccgcgcgcacgccacaggcgggcgcgttgaccttcgccggc
cagcacttgacctacgccgagctcgaccagcaggccaaccgcctggcgcgtgccctgcgc
gaacgaggtgtcggcccgcaggtgcgggtgggcctggcgctggagcgctcgctggaaatg
gtcgtcggcctgctggccatcctcaaggccggcggcgcctatgtaccgctcgaccccgag
tacccgctcgaccgcctgcgctacatgatcgaagacagccgcatcggcttgctgctcagc
cagcgtgcgctactgcacaccctgggcgagttgcctgaaggcgtggccagctggagcctg
gaagacgatgccgccagcctggcggcctacagcgatgcgccgctggacaacctcagcctg
ccgcagcaccaggcttacctgatctacacctcaggctctaccggcaaacccaagggcgtg
gtagtcagccatggcgagttcgccatgcactgccaggcggtgatcgctgcattcggcatg
cgcagcgatgactgcgagctgcacttctattccatcaacttcgacgctgccagcgagcgc
ctgtgggtgccgctgttgtgtggtgcgcgcgtggtattgcgcgcccaggggcagtggggc
gccgaggacatctgccagttggtgcgcgagcagcaggtgagcattctgggctttactccc
agctacggcagccagctggcgcagtacctgggcgggcggggcgaacaattgccggtacgc
ctggtgattaccgggggcgaggcgctgaccggcgagcacctgcagcgtatccgccaggcc
tttgcgccgcagcagtgcttcaatgcctacggcccgaccgaaaccgtggtcatgccgctg
gcgtgcctggccccagaggccttgccagcagaccttggcagcgtaccgatcggccgcgtc
atcggtagccgtacggcctacatcctcgacgaggatctggccttgttgccgcaaggcggt
attggcgaactgtacgtcggcggtgccggcctggcccagggttaccacgaccggccaggc
ctcactgccgagcgctttgtcgccgacccgttcagtgccgaaggcgggcgcctgtaccgt
accggcgacctggtacgcctgggtatcgatggcctggtggagtatgtcggccgtgccgac
cagcaggtgaagatccgcggcttccgcatcgaactgggcgaaatcgagagccgcctgcaa
gcgcacgaggctgtcgacgaggccgtcgtgctggcgctggacttgccgggcggcaagcaa
ctggtgggctatctggtgtgcaggcaggccaccgccggtaacgacgtgcaacaactgctg
cgcgaagcggtgaaagccgatgcccgccagcacctgcccgactacatggtgcctgcgcac
ctggtgctgatcgatagcctgccgctgatgggcaacggcaagctcgaccgccgtgcgctg
ccgctgccggaccttgagcagacgaggcagcaataccaggcccctggcaatgaggtggaa
gcacagttggcgcagatctggcgcgaggtgctcaacgttgcccgggtcggcgtgcaggac
aacttcttcgagctggggggcgactcgatcctgtcgattcaggtggtcagccgcgcccgg
caggccggcttgcaattcaccccacgcgacctgttccagcatcagaccatccagactctg
gcaactgtggttcagctcagcgaagccgcgagcaccgtcgagcagggcctgcgccagggc
caggccgggctgacgccgatccagcactggttcttcgacagtgacgtgccacagccgcaa
cactggaaccaggccgtgctgctggaggtgcgccaacccttggttgaggccacccttgaa
caggcattggctgcgctggtgcagcaccatgacagcctgcgcctgcgcttcagcgacgcc
cagggccgctggcaggcgcagtacgcgcagcctggcgccgagcaactgctgtggagcgcc
actgtcgccgatttcaatgattgtcaggcactctacactgacgtgcagcgcagcctggac
ctgcaacaggggccgctgctgcgcgccttgctggtgcgtgacgggcagggcacccagcgg
ttgttgctggcgatccatcacctggtggtcgatggtgtgtcctggcgggtgctgctggaa
gacctgcaggcgctgtaccgtggccagcctctgccggccaagacccacgccgtcggcgac
tgggccgcgcgcctggccagctacgccggcagcgattcgctgcgtgacgaactggcctgg
tggcaaggccagctgggcggtgtgcgtcgcgaattgccgtgcgaccatccgcagggcggc
aatttgcatcgccacgctcaaaccctggccatcggcctggacgtggagcaaacccggcag
ctgttgcaactggccccggcggcttaccacacccaggtcaacgacctgctgttgactgca
ctggcgcgggccttgtgccgctggagcggcgatgaagaagtgctggtgcagctcgaaggc
catggccgtgacgggttgttcgaagatatggacctgacccgcagcgtcggctggttcacc
aatgcctacccactgagcctgcgtccgctgccaggtgaagacgacgcggcgcgggccggt
tcgatcaagcgcatcaaggaacaactgcgccatgtaccgcacaagggcctgggctacggc
gtactgcgctacctggcggatgccgccgggcgcgagcagatggcggccttgccgcaggcg
cgcatcaccttcaactacctgggccagttcgaccagcagttcgacagtgcggccttgttc
cagcccctggaagccccggccgggttggcacatgacctcgatgcgccgttgcccaactgg
ttgagcgtcgatggccaggtgtatggcggtgctctgcaactgcgctggaccttcagcgcc
gagcgctacgaccagcagaccatcgcgggtctggctgagggctatcgtcaggagctgctg
gcgctggtcgcgcattgcctggccgatggcaatggcagcttcaccccatcggacttcccg
ctggcgcacctgactcaggagcagatcgacgcattgccggtcccggccgcgcagatcgag
gacgtttacccgctgacgccgatgcaggaaggcatgctgctgcacaccctgctggagccg
ggcactggcctgtactacatgcaggaccgctaccgcatcaacagcgccctcgaccccgag
cgtttcgcccaggcctggcaggccgtggtggcgcgccacgaagcgttgcgcgcctcgttc
agctggaacagcggcgaggcgatgctgcagatcatccacaagccgggcaacctggcgatg
gactaccaggactggcgcggcctggccgacgatgcccaggagcagcgcctgcaggccctg
cacaagcaggagcgcgaggccggctttgccttgctcagcgaggcaccgttccacctgcgc
ctggtgcgcgtggccgatgaacgctactggttcatgatgagcaaccaccacatccttatc
gatgcctggtgccgctcgctgttgatgaacgatttcttcgaggtctaccaggcccttggc
gaaggccgtcaggcccaactgccggtgccaccgcgttaccgcgattacatcggttggctg
caacgccagggtctggacgacgcacgcgcctggtggcaggccaacctggccggcttcgaa
cgtgccacagccatcccgagcgaccgtccgctgcgccatgaccacgccggtagcggcatg
gtcgtcggcgattgttatacccgccttgaggtgaatgatggcgtgcgtctgcgcgaactg
gcccaggcccatcagctcaccgtcaacactttcgcccaggcggcctgggccctggtgctg
tcgcgctacagcggcgaccgcgacgtggcctttggcgtaaccgtggccgggcgcccggtg
agcatgccgcagatgcagcgcaccgtcggcctgttcatcaacagcgtggccctgcgcgtg
cagttgcccgcggcgggtgagcgttgcagcgtacgccagtggctgcagggcctgctgcaa
agcaacatggaactgcgcgagtacgaatacttgccgctggtggcgatccaggcgtgcagc
gagctgcccaagggccagccgctgttcgacagcctgttcgtgttcgagaatgcgccggtt
gaaaccgccgtgctcgatcacgcccagcacctgaacgccagctccgactcgggccgtacc
cacaccaacttcccgctgacggcggtgtgttacccgggtgatgacctgggcctgcacctg
tcgtttgaccagcgttacttcgattacccgaccgtcgagcgcctgctggccgagttcaag
cgcctgctgctggcgctggtacaaggttttgaaggggaggtgagcgagctaccgttgctg
agcgcccaggagcaaggcttcctgctggaggactgcaaccggaccgagcgggtttatccg
ctggaacaaagctatatcgcgcagttcgaagcgcaggtcgtggcgcatccacagcgtacc
gtggcccgctgcctggaggcatcctatgattacgccgggctgaacctggcggccaaccgc
ctgggccatacgctggtggctgccggcgtctgcgtggaccagccagtggcactgcttgcc
gagcgtgggttgccgctgctgggcatgattgtcggcagcttcaaggccggcgccggctac
ctgccgctggacccgggcctgccggcggcgcgcctgcaaagcatcatccagctcagccgc
acgccagtgctggtgtgcagcgcggcctgcgccgagcaggggcggcagttgctcggtgag
ctggaggctgcgctgcggccgcaactgctggtctgggaagacgtccaggccaacccgatc
gcaagccacaacccgggcatccacagtggcccggacaacctcgcctacgtgatctacacc
tcaggctcgaccggcctgccgaaaggggtgatggtcgagcagcgcggcatgctcaacaac
cagctgagcaaggtgccttacctggcgctgagcgagcaggacgtgattgcccagaccgcc
tcgcagagtttcgacatttcggtctggcagttcctggctgcgccgctgttcggcgccaag
gtagagatcgtgcctaacgccatcgcccatgacccgcagggcctgctggcgcatgtgcaa
accaccggcatcaccgtgctggagagcgtgccgtcgctgatccagggcatgctggccagc
gaccgccaggccctcgacggcctgcgctggatgctgccgaccggcgaggccatgccaccg
gagctggcggcgcagtggctgcagcgctacccgcagatcggcctggtcaatgcctatggc
ccggcggagtgctcggatgacgtggcgttcttccgcgtcgatgccgcctcgacccaaggc
agctacctgccaatcggcacgccaaccgataacaaccgcctgtacctgttcggcgaggac
caggcgctggtgccgctgggggcggtgggcgagttgtgcgtggcgggtgcgggtgtaggc
cgtggctacgtcggtgacccggtgcgcacggcactggcgttcattcctcacccttacggg
gcaccgggagagcgcctgtaccgtaccggtgacctcgcacggcagcgcctggacggtgtg
ctggagtacgtcgggcgcatcgaccaccaggtgaagattcgcggctatcgcatcgaactg
ggcgaaatcgaggcccggctgcatgagcaggcggaaattcgcgatgccgccgtggcggtg
caggagggcgtgaacggcaagcatctggttggctacctggtggcgcaccagggcgtcagt
gccgatgccgcgttgctggagcaggtcaagcaacgactgcgtgccgagttgccggagtac
atggtgcccttgcactggggctggttcgacagcttgccgcacaacgccaacggcaagctc
gaccgcaaggccctgccagccatcgacatcggcggtcagtacagtcaggcctatctggcg
ccacgcaacgaattggaggacgtgttggcggttatttgggccgatgtgctcaaagccgag
cgggtgggggtgcacgacaacttcttcgagctgggcgggcattcattgctggccacgcag
atcgcttcgcgggtgcagaagcagttacagctgaacgtgccgctgcgggcgatgttcgag
tgcagcacggtggaggcgttggccgagtatgtacaggggctgcagggcagtgcgctggat
gatgacaaggtcgatcggctcagtgacctgatggcggagctggaggggctgtga

DBGET integrated database retrieval system