KEGG   Pseudoalteromonas piscicida: B1L02_14960Help
Entry
B1L02_14960       CDS       T04942                                 

Definition
(GenBank) hypothetical protein
Organism
ppis  Pseudoalteromonas piscicida
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1:3230088..3231728
Genome map
AA seq 546 aa AA seqDB search
MRLSYQLASSTPTRDVFLAALNEKQAGIYFYQSDLKTKEFLTYFEIAQQARTFIPMLSAL
GIKQKTRVLLCAENTKEFVIAWFALLQIGAVPVPMPPSATLAGDNQFAARVEPMLAHHEH
FICRQGDVDKLATANITFINIAGFSNCLESDSSPITLPSFADSDEAFIQYTSGSTSAPKG
IVINYRNIVENTAALASATQTDKQPTFLTWLPLYHDYGLICNFMLCLLQGYDLIITLPMA
FIKRPIKFLQLVGEHQATSMCMPNFALEHIHKAVVQKQAALDLDLCSVQWWSIGAEPISV
QAMENLYEVLSPYGLAATALSPSYGLAEATVGVSVSRPNTPYETALLNQRKVILNGQPIN
GLEIEIRNKDKQGFGELWLRGDSIAKHAYVDGKKLSITDPKGYVFTKDIAAIISNQVVIS
GRQDEMICLRGENIFPYDIEALVRQLTELPIRRVACFFVPTNNNVKTVLMYESKEKHVHL
HEQLHQQIFAHIAAHSTLKVDEMIAVPTKAVPVTTSGKIQRTKARNQYIQTGYKDIAVLR
TTRASA
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttaagttatcagctcgcaagttcgaccccaacacgtgacgttttccttgcagcc
ctaaatgaaaaacaagctgggatctatttttatcaaagtgacttaaaaaccaaagaattt
ttgacttactttgaaattgcgcaacaagctagaacattcattccgatgttaagcgcatta
ggcataaaacaaaaaacgcgggtgttactctgtgcggaaaataccaaagagtttgttatt
gcttggtttgcgctattacaaataggcgcggtaccggtgccaatgccaccgtcagcaact
ctcgcaggtgataatcagtttgcagctcgggtagagcctatgctggctcatcatgagcac
tttatttgtcgccaaggagacgttgataaattagcaacagcaaacatcacatttattaat
attgctggattttcaaactgtctagagagcgatagttcaccgattacattaccttctttt
gctgacagtgatgaagcatttatacaatacacttctggctccacatcggcgccaaaaggc
atagtgatcaactatcgaaatattgtcgaaaatacagcagcattagccagtgcgactcag
actgacaagcagccaacctttctaacttggctgccgctgtaccatgactacgggttaatt
tgtaatttcatgctgtgtttattacaaggttatgatcttatcattaccttgcccatggct
tttataaagcgtccaattaagtttttacagctggtaggtgaacaccaagcaacgtcgatg
tgtatgccgaactttgccttagaacatatacataaagcggtagtgcaaaaacaagcagcg
ctggatttagatctttgttcagtgcaatggtggtcaattggtgccgagcccatttctgtg
caagcaatggaaaacttgtacgaagtgttatctccttacggcttagccgctacggcacta
tcgccatcttatggacttgctgaagcaacggtaggcgtgagtgtctcgcgtcccaataca
ccatatgaaaccgcattgcttaatcaaagaaaagtcatactcaacggacaacctattaat
ggcctagaaatagaaatcagaaataaagataagcagggttttggggagctgtggctacgt
ggagatagcatagcaaaacatgcctatgttgatggaaagaaactctcaatcaccgatccc
aaaggttatgtgtttacaaaagatattgccgctattatttcaaatcaggtagtcatctca
ggccgtcaagatgaaatgatatgcctacgcggagaaaatatatttccctatgacatcgaa
gcgcttgtacgacaacttactgaacttccaattcgccgtgtagcatgcttttttgtaccg
acgaacaacaacgtaaaaacggtcttgatgtatgagtcaaaagaaaagcatgtccaccta
catgagcaacttcatcaacaaatatttgcccatatcgctgcacatagcacattaaaagta
gatgaaatgatagcggttccgaccaaagcggttcctgttacaacttctggcaaaattcaa
agaacgaaagccagaaatcagtatattcaaaccggatataaagatattgcagtgttaaga
acaacgagggcaagcgcatga

DBGET integrated database retrieval system