KEGG   Pseudoalteromonas piscicida: B1L02_23035Help
Entry
B1L02_23035       CDS       T04942                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
ppis  Pseudoalteromonas piscicida
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppis00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B1L02_23035
Enzymes [BR:ppis01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     B1L02_23035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:1027052..1029055
Genome map
AA seq 667 aa AA seqDB search
MKNIKLNQIAAGVLLASSCITPAHAAEGDPTTFVHLFEWSWADVATECETFLGPKGYAAV
QVSPPNEHITGDQWWTRYQPVSYEITSRSGSRAEFADMVARCKSAGVDIYVDAVINHMAH
GSGTGVAGNAFGNKQYPIYSPQDFHETCAINPEDYGNNAWRVQHCELVGLHDLDTDASYV
QNTLAGFLNDLQSLGVAGFRLDASKHMPASDIGDVLAKLNQPAVVFQEVIDQGGEAVSAS
EYHQNGLVTEFKYSIKLSETFKQGKLAWLKSFGEAWDMMPSYKAVVFTDNHDNQRGHGGA
GSIVTFHDGKLYDLANVFMLAYPYGYPKVMSSYEFNGDTDAGGPSVPVHQNGNLNCTSQL
WQCEHRRPMVAGATQFRNHTNGNWTVANWWDNGNNQIAFSRGDLGFVAINRESSSMVQSL
QTGLSAGTYCDVLSGGIAHENCAGRRIEVDTSGYAQINLAAMDAVAIHHQSKLATPPPSG
DWQRTLVFIKAETQAGQDMFVRGGLDHGAALQRGIDCSTEPTLCSLPIKHLNMRNTTTSV
WKTADTRLDWLAAETGQSSGAEGSPLDWTTNIWPASWGAEKHYESDGFGVMSLNQWGAHY
WLLEVEMDCSKTFNGWFEVKAFVKSGQGWEGDINQQNTPYASNNHFGQCGKLNVFEFGTN
LASISSL
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatataaaactaaaccaaattgcagcgggggtgttgttagcatccagttgcatt
acacctgcacatgccgctgaaggcgacccaacaacattcgttcatttattcgagtggtct
tgggcagatgttgctacggaatgtgaaacgtttttggggccaaaaggctacgcggctgtg
caagtatcgccacccaatgagcatattacaggggaccaatggtggactcgttatcagcca
gtcagttatgagattacgagtcgtagtggaagtcgagccgaatttgccgatatggtcgcg
aggtgtaaatctgccggagtagacatctatgttgatgccgttataaaccacatggcccat
ggcagcggcaccggagttgcgggtaacgcttttggcaacaaacaatatcctatctatagt
ccacaagattttcatgagacctgcgcaataaaccctgaagactatggtaataatgcatgg
cgagtacagcactgcgaactcgttgggcttcatgatttagacactgatgcgagctacgta
caaaataccctcgcgggctttttgaacgatttacagtctctgggcgtggcagggtttagg
ttggatgcaagcaagcacatgcctgcaagtgatattggcgatgtgttagccaagctaaat
caaccagcggtcgttttccaagaggtgattgaccaaggaggcgaggcggtttctgcttct
gagtatcatcaaaatggcttagtcaccgagtttaaatacagcattaaactgagcgagaca
tttaagcaaggcaagttggcttggttaaaaagctttggcgaagcgtgggacatgatgcca
agttataaagccgtagtatttacagacaatcatgacaaccagcgcgggcatggtggtgca
ggctctatcgttacttttcatgatggtaaactatatgacttagccaatgtatttatgctg
gcatatccttatggctaccctaaagtgatgtctagttacgagtttaatggcgacactgat
gctggaggcccttcggtgcctgttcatcaaaatggcaaccttaattgcactagtcaatta
tggcagtgtgagcatcgtcgcccaatggtcgcaggagcgacgcagtttagaaatcatact
aatggcaattggacggtagcaaactggtgggacaatggtaataaccaaattgcattttct
cgaggtgatttgggctttgtcgccataaaccgagaatcttctagtatggttcaaagcctg
caaacagggctttcagcaggaacctattgtgatgtgctaagtggaggtatcgctcacgaa
aactgcgcaggccgacgcatcgaagttgataccagtggttacgcacaaattaatttagct
gctatggatgccgtcgccattcatcatcaaagtaaactggcaacaccaccgccgtctggt
gattggcaacgtacacttgtgtttattaaagccgaaactcaagctggtcaggatatgttc
gtccgtggtggtcttgatcacggagctgcattgcaacgagggattgattgtagcaccgaa
cctactctttgctctttacctatcaagcacttgaacatgcgaaacacgacaacctcggtt
tggaaaacggctgatacgagactggattggctagcggctgaaactgggcagtcgagtggc
gccgaagggagcccgctggattggacaaccaatatttggcctgcaagttggggcgcggaa
aaacattacgaaagcgatggcttcggcgtcatgtctcttaatcaatggggagcacattac
tggctgctggaagtagaaatggactgtagcaaaacattcaatggttggtttgaagtaaaa
gcattcgttaaaagtggtcaaggttgggaaggcgacattaaccaacaaaacacaccatat
gcgagcaataaccatttcggccaatgtggaaaattgaatgtgtttgagtttggcacaaac
ttagcctctatctcttctctataa

DBGET integrated database retrieval system