KEGG   Pseudomonas plecoglossicida: RK21_00863Help
Entry
RK21_00863        CDS       T03646                                 

Definition
(GenBank) peptide synthase
Organism
ppj  Pseudomonas plecoglossicida
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
932338..945291
Genome map
AA seq 4317 aa AA seqDB search
MTDAFELPLSLVQALAQRAVQTPDKVALRFLADAPGEQAVLSYRDLDQRARTIAAALQSR
AGFGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESARQHHQQRLLSIIDDAEPRLL
LTVAALHDSLQGLEALTAANAPELLAVDGLDPALAANWREPALKGDDIAFLQYTSGSTAL
PKGVQVSHGNLVANEQLIRQGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVL
MSPGYFLARPLRWLQAISEYGGTISGGPDFAYRLCSERVSEASLAGLDLSRWRVAYSGSE
PIRQDSLAAFADKFQACGFDPQSFFASYGLAEATLFVSGSRRGQGIAALELDAEAFAANR
AEPGKGSVLMSCGYPQPGHAVRIVEPQRLQVLGDNQVGEIWAAGPSIALGYWRNPEASAR
TFVEMGGQTWLRTGDLGFMREGEVFVTGRLKDMLIVRGQNLYPQDLEKTLEREVEVLRKG
RVAVFAVEQQGEEGIGVAVEISRNVQKAIKPQELIKTLRQVVADACRQAPAVVLLLNPGA
LPKTSSGKLQRSACRLRMDDGSLDCYARFPEVGEPVASVGEGDELQARIAGVWRDILKVE
AVAADDHFLLLGGNSIAATHATARLADELGIELGLRTLFEAPILADYAKAVAAIIAEGGD
RVGAIATLECTQALPQSLAQNRLWLLWQLDPQSAAYNIPAGLQLRGELDENALETAFQAL
VARHESLRTLFAEENGQALQRIQAQQPFDLRRLDLEGQAAEQVAAQRETEARQPFDLTRG
PLLRVTLARLDDEHHQLWVTLHHIVADGWSLNILLDEFAKLYAAHCQGLEANLAPLTLGY
ADYGTWQRQWLAAGEAERQLQYWQARLGDDLPVLDLCTDHPRTSQRGHRAARFNLKVPAR
LTEALKGLAREQQASLFMVLLAGWQALLHRYSGQADIRVGVPNANRPRLETQGMVGFFIN
TQVLRAQLDGRLPFEQLLAQVRQTTLDAQANQDLPFEQLLEALPEAREQGLFQVMFNHQQ
RDLSALRRLPGLLAEELPWHSREAKFDLQLHSEEDHQGRLSLAFDYAAELFDASTVKRLA
QHLLALLEQVCAGPQRALGEVQLLDESGRAQLLSWGEAPAAAPQRLLVEQLNEQARLTPQ
RTALVWDGGSLDYAELHQQANRLAHYLRDKGVGPDTCVAIAIERSPQLLVGLLAILKAGG
AYVPLDVDYPAERLAYMLADCNAGLLLSHSSLLGKLPQVDGVSAIALDQLHLDSWPSHAP
GLHLHGDNLAYVIYTSGSTGQPKGVGNTHAALAERLQWMQASYVLDDSDVLMQKAPISFD
VSVWECFWPLVTGCKLVLAGPGEHRDPQRIAALVQAHGVTTLHFVPPLLQVFVQEPQAGA
CGSLRRLFSGGEALSAALRDRVLQVLPQVQLHNRYGPTETAINVTHWHCQSTDGERSPIG
RPLGNVLCRVLDDELELTAPGVPGELYLGGAGLARGYLGRPGLTAERFVPQADGNGERLY
RSGDRARWQVQTEALEYLGRLDQQVKVRGFRVEPEEVQACLLAQPGVEQALVLIHKDAVG
AQLVGYYSGSAQPDALLTVLAEQLPAYMVPAQLIPLAQMPLGPSGKVDRKALPAPVWQQR
QHVEPQTELQQQVAAIWREVLNLPRIGLQDDFFALGGHSLLATQIVSRTRQACDVELPLK
ALFDASELGAFCAEITRIRAAGERNLQGAITRVDRRQAVPLSYSQQRMWFLWQMEPGSPA
YNVGGMARLRGTLHVDAFERALQALVVRHETLRTTFPSIDGVPYQCVADDSSLHLDWQDF
SALPADLRQQRLQQLADDHAHQPFDLERGPLLRACLVKAEEREHFFVLTLHHIVTEGWAM
DIFARELGELYEAFVDDRESPLAPLPVQYLDYSVWQRQWLESGEGARQLAYWQARLGDEH
PVLALPADRPRPAVQSHRGELYRFELDPALVARVHAFNSQRGLTLFMTMTATLAALLHRY
SGQRDLRIGAPVANRIRPESEGLIGAFLNTQVLRCELDGQMSAAQLLEQVRQVAIEGQSH
QDLPFDQLVEALQPPRSSAYNPLYQVMCNVQRWAFQQSRQLAGMQVDYLVNDASATKFDL
YLEVTDLDGRLGCCLTYSRDLFDEPRIARMAEHWQQLLVGLLDNPQQRLCELPMLSSAEQ
QLLAGQLQGEQGLALDQTVHGLFAAQAARTPHAGALTFAGRHMTYAELDQQTNRLARALR
ERGVGPQVRVGLALERSLEMVVGLLAILKAGGAYVPLDPEYPLDRLRYMIEDSRIGLLLS
QRALLQTLGQLPEGVAHWSLEDDSASLSAYSDAPLDNLNLPQHQAYLIYTSGSTGKPKGV
VVSHGEFAMHCQAVIEAFGMRSDDCELHFYSINFDAASERLWVPLLCGARVVLRAQGQWG
AEDICQLVREQQVSILGFTPSYGSQLAQYLAGQGEQLPVRLVITGGEALTGEHLQRIRQA
FAPQQFFNAYGPTETVVMPLACLAPQTLPAELGSVPIGRVIGSRTAYILDEDLALLPQGG
IGELYVGGAGLAQGYHDRPGLSAERFVADPFGSEGGRLYRTGDLVRLGSDGLVEYVGRAD
QQVKIRGFRIELGEIESRLQAHADIDEAVVLALDLPGGKQLVGYLVCRQAAADSEAQGLL
RDAVKADARKHLPDYMVPAHLVLLDSLPLMGNGKLDRRALPLPDLEQARQQYQAPGNEVE
AQLAQIWRDVLNVARVGVQDNFFELGGDSILSIQVVSRARQAGLQFTPRDLFQHQTIQTL
AAIVQRSEAASSIEQGLRQGQAGLTPIQHWFFDSEVPQPQHWNQAVLLEARKPLDEGVLK
RALADLVQHHDSLCLRFGQAQGRWQAEYASPASGQLLWTATVADFADCQPLYTDLQRSLN
LEQGPLLRALLVNDGQGGQRLLLAIHHLVVDGVSWRVLLEDLQALYRGQPLPAKTHAMGD
WAARLASYAGSDSLRDELGWWQGQLGGVRRELPCDHPQGGNLHRHARTLAIGLDVAQTRQ
LLQQAPAAYHTQVNDLLLTALARALCRWSGDEEVLVQLEGHGRDGLFEDMDLTRSVGWFT
NAYPLSLRPLPGEDDAARAGSIKRIKEQLRQVPHKGLGYGVLRYLADTAVREQMAALPQA
RITFNYLGQFDQQFDSTALFQPLDAPAGLAHDLDAPLPNWLSVDGQVYGGALQLRWTFSA
ERYDERTIACLAEAYRQELLALVEHCLADGNGSFTPSDFPLAHLTQAQIDALPVPAAQIE
DVYPLTPMQEGMLLHTLLEPGTGLYYMQDRYRINSALDPERFAQAWQAVVARHEALRASF
SWNTGEAMLQIIHKPGNMPVDYQDWRGLDDDVQEQCLQALHKQEREAGFALLSEAPFHLR
LVRVADERYWFMMSNHHILIDAWCRSLLMNDFFEIYQALGEGRQARLPVPPRYRDYIGWL
QRQGLDDARAWWQANLAGFERATTIPSDRPLRHDHAGSGMIVGDCYTRLALSDGVRLREL
AQAHQLTVNTFAQAAWALVLARYSGDRDVAFGVTVAGRPVSMPQMQRTVGLFINSVALRV
QLPVAGERCSVRQWLQGLLERNMELREYEYLPLVAIQECSELPKGQPLFDSLFVFENAPV
ETAVLDHAQHLNASSDSGRTHTNFPLTAVCYPGDDLGLHLSFDQRYFDYPTVERLLAEFK
RLLLALVQGFEGEMSALPLLGAEEQRFLLEDCNRTARAYPLEQSYIAQFEAQVAAHPQRT
VARCLDASYDYAGLNLAANRLGHALIAAGVSVDQPVALLAARGLPLLGMIVGSFKAGAGY
LPLDPGLPAARLQSIIQLSRTPVLVCSAACAGQGRQLLDQLALAARPQLLVWEDIQASPV
ASHNPGIHSGPDNLAYVIYTSGSTGLPKGVMVEQRGMLNNQLSKVPYLALGEHDVIAQTA
SQSFDISVWQFLAAPLFGARVEIVPNAIAHDPQGLLAHVQATGISVLESVPSLIQGMLAN
GHQALEGLRWMLPTGEAMPPELAAQWLQRYPQIGLVNAYGPAECSDDVAFFRVDAASTRG
SYLPIGTPTDNNRLYLYGEDQTLVPLGATGELCVAGTGVGRGYVGDPVRTALAFIPHPHG
APGERLYRTGDLARQRPDGVLEYVGRIDHQVKIRGYRIELGEIEARLHEQPEIRDAAVGV
QEGVNGKHLVGYLVAHQGVAADAALLEQLKLRLRAELPEYMVPLHWGWFDSLPHNANGKL
DRKALPAIDIGGQHSQAYQAPRNELEEVLAGIWADVLKADRVGVHDNFFELGGHSLLATQ
IASRVQKQLQLNVPLRAMFECSTVEELAVYVQGLQGSVLDDDKVDRLSDLMAELEGL
NT seq 12954 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgccttcgaactcccgctctcgctggtccaggccctggcgcagcgcgccgtg
cagaccccggacaaagtcgccttgcgctttctggccgacgctcccggcgagcaggccgtg
ctcagctaccgggacctcgaccagcgcgcacgcaccatcgctgctgccttgcaaagccgg
gccggtttcggcgaccgcgcagtgctgttgttccccagcgggccagactatgtggcggca
ttcttcggctgcctgtatgccggtgtgattgcggtgccggcctacccgccggagtccgcg
cgccagcaccaccagcagcgcttactgtcgatcatcgacgacgccgagccgcgcctgctg
ctgactgtcgcggccctgcacgacagcctgcagggcctggaagccctgacagcggccaac
gcccccgaactgctggcggtggatggcctggacccggcactggctgcaaactggcgcgaa
cccgcgctcaagggtgatgacatcgccttcctgcaatacacctccggctccacggcactg
cccaagggcgtgcaggtcagccatggcaacctggtggccaacgaacaactgatccgccaa
ggctttggcatcgacctcaaccccgacgacgtgatcgtcagctggctgccgctgtaccac
gacatgggcctgatcggcggcctgctgcagccgatcttcagcggcgtgccctgtgtgctg
atgtcgccgggctacttcctggcccggccgctgcgctggttgcaggccatcagcgagtac
ggcggcaccatcagcggcggccccgacttcgcctaccggttgtgcagcgagcgggtcagc
gaggcctccctggccgggctcgacctcagccgctggcgggtggcctattctggctccgag
ccgatccgccaggacagcctggcggcctttgccgacaagttccaggcctgcggcttcgac
ccgcagagcttcttcgccagctacggcctggccgaggcgaccctgttcgtcagcggcagc
cgccgtggccagggcatcgccgcgctggagctggacgccgaagccttcgccgccaaccgt
gcggagccaggcaagggcagtgtgctgatgagctgtggctacccgcagcccgggcatgcc
gtgcgcattgtcgaaccacaacgcctgcaagtactaggcgacaaccaggtgggcgagatc
tgggccgccggcccgagcatcgccctgggctactggcgcaaccccgaggccagcgcccgc
accttcgtcgagatgggcggccagacctggctgcgtaccggcgacctgggcttcatgcgc
gaaggggaagtgttcgtcaccggtcgcctgaaggacatgctgatcgtgcgcgggcagaac
ctgtacccgcaggacctggaaaagaccctcgagcgcgaagtggaggtgctgcgcaaaggc
cgggtggcagtgttcgccgtcgagcagcaaggcgaggagggtattggcgtggcggtggaa
atcagccgcaacgtgcagaaggcgatcaagccccaggagctgatcaagaccctgcgccag
gtggttgccgacgcctgccgccaggccccggccgtggtcctgctgctgaacccgggggcg
ctacccaagacctccagcggcaagctgcagcgttcggcctgccgcctgcgcatggacgat
ggcagcctggactgctatgcccgcttccctgaggtgggcgagcccgttgcttcagtgggc
gaaggcgatgaactgcaggcacgcatcgccggtgtgtggcgcgacatcctcaaggtcgag
gcggtggcggcggacgaccacttcctgctgctgggcggcaactccatcgccgccacccac
gccaccgcacgcctggccgatgaactgggcatcgagctgggcctgcgcaccctgttcgaa
gcgccgatactggctgattacgccaaggccgtggccgcgatcatcgccgaaggcggtgac
cgggtcggtgccatcgctacactggaatgcacccaggcgctgccccagtcgctggcgcaa
aaccgcctgtggttgctgtggcagttggacccgcagtcggcggcctacaacattccggcc
ggcctgcagttgcgcggtgagctggacgaaaacgccctggaaacagccttccaggcgctg
gtggcgcgccatgaatcgctgcgcaccctgtttgccgaagagaacggccaggccctgcag
cgcatccaggcgcagcagccgttcgaccttcgccgcctggacctcgaaggccaggccgcc
gaacaggtcgccgcccaacgtgaaaccgaagctcgccagccgtttgacctgacccggggg
ccgttgctgcgggtgaccctggcgcgcctggacgatgaacaccatcaactgtgggtgacc
ctgcaccatatcgtcgccgacggctggtcgctgaacatcctgctcgacgaattcgccaaa
ctgtacgccgcccattgtcagggccttgaggccaacctggcaccgctgaccctgggttat
gccgactacggcacctggcagcgacagtggctggccgcaggcgaagccgagcgtcagctg
cagtactggcaggcgcgtctgggggatgatctgccggtgctcgacctgtgcaccgaccac
ccgcgcaccagccagcgcggccaccgcgccgcccgcttcaacctcaaggtaccggccagg
ctcaccgaagcgctcaagggcctggcccgcgaacagcaggccagcctgttcatggtactg
ctggccggctggcaggcgctgttgcaccgctacagtggccaggccgatattcgtgtcggc
gtgcccaacgccaaccgcccgcgcctggaaacccaaggcatggtcggcttcttcatcaac
acccaggtgctgcgtgcgcagctcgacggccgcctgccgttcgaacagttgctggcccag
gtgcgccagaccaccctggatgcccaggccaaccaggacctgccgttcgagcaactgctc
gaagccctgcccgaggctcgcgagcaaggcctgttccaggtcatgttcaaccaccagcaa
cgtgacctgtctgcgctgcgccgcctgccgggcctgctggctgaagagctgccgtggcac
agtcgcgaagccaagttcgacttgcagctgcacagtgaagaagaccatcagggccgcctg
agcctggccttcgactatgccgccgaattgttcgatgccagtaccgtcaagcgcctggcc
cagcacctgttggccctgctcgagcaggtgtgtgccgggccgcagcgggcgctgggcgag
gtgcaactgctcgacgagtctggccgcgcgcaactgctgagctggggcgaggcacccgct
gcggcgccgcagcgcctgctggtcgagcagctcaatgaacaggcacgcctgacccctcag
cgcaccgccctggtgtgggacggtggcagcctggattacgccgagttgcaccagcaagcc
aaccgtctggcccactacctgcgtgacaaaggcgtgggcccagacacttgcgtggccatt
gccatcgagcgttcgccgcagctgctggtgggcctgctggccattctcaaggccggtggt
gcctatgtgccgctggacgtcgattacccggccgagcgcctggcctacatgctcgccgac
tgcaacgctggcctgttgctgagccacagcagcctgctgggcaagctgccacaggttgat
ggcgtcagcgccatcgcactcgaccagctgcacctggacagctggccaagccatgccccc
gggttgcatctgcatggcgacaacctggcctatgtgatctacacctccggctctaccggc
cagcccaagggcgtgggcaatacccacgcggcactggccgagcgcctgcaatggatgcag
gccagctatgtgctggacgacagcgacgtgctgatgcagaaggcgccgatcagcttcgac
gtttcggtgtgggaatgcttctggccactggtgaccggttgcaagctggtgctcgccggc
cctggcgagcaccgcgacccgcagcgcatcgccgcgttggtgcaggcccatggcgtgacc
acgctgcacttcgtgccgccgctgttgcaggtgttcgtccaggagccgcaggcgggtgcc
tgcggcagcctgcgccggctgttctccggtggcgaagcgctgtccgcggcactgcgtgac
cgcgtgctgcaggtgctgccacaggtgcagttgcacaaccgctatggcccgaccgaaacc
gccatcaacgtcacccattggcactgccagtccaccgatggcgaacgctcgccgatcggc
cgcccgctgggcaatgtgctgtgccgtgtgctggatgacgagctggaactgaccgccccc
ggtgtgcccggcgagctgtacctcggcggtgcaggcttggcccgtggctacctgggccgc
ccgggcctcaccgccgagcgcttcgtgccccaggctgacggcaatggcgagcgcctgtac
cgcagtggcgaccgcgcccgctggcaggtgcagaccgaggcgctggaataccttggccgc
ctagaccagcaggtcaaggtgcgtggcttccgtgtcgaacccgaggaagtccaggcctgc
ctgctggcgcagccgggggtcgaacaggcgctggtgctgattcacaaggatgccgtaggt
gcgcaactggtcggctactacagtggcagcgctcagcctgatgcattgctgacggtgctg
gctgaacaactaccggcctacatggtgccggcacaactcatcccgctggcgcagatgcca
ctgggccccagcggcaaggtcgaccgcaaggcattgcccgccccggtgtggcagcagcgg
caacacgtcgagccgcaaaccgagttgcagcagcaggtcgccgccatctggcgcgaggtg
ctgaacctgccgcgcatcggcttgcaggatgacttcttcgccctcggcggccattcgctg
ctggccactcaaattgtctcgcgcacgcgtcaggcctgcgatgtcgaactgccgctcaag
gccctgttcgacgccagcgagctgggcgccttctgtgccgagatcacgcgtattcgtgct
gccggtgagcgcaacctgcaaggcgcaatcacccgcgtcgaccgccgccaggcggtgccg
ctgtcgtactcgcagcagcgcatgtggttcctctggcaaatggagccgggcagcccggcg
tacaacgtcggcggcatggcgcgcttgcgcggcaccctgcatgtggatgctttcgagcga
gcgttgcaggcgctggtggtgcgccacgaaaccctgcgcaccaccttccccagcatcgat
ggcgtgccgtatcagtgcgtggccgacgacagcagcctgcacctcgactggcaagacttc
agcgccttgcccgccgatctccgccaacaacgcctgcagcaactggccgacgaccatgcg
caccagccgttcgacctggagcgcggcccgctgctgcgtgcctgccttgtcaaagccgaa
gagcgcgagcatttcttcgtgctgaccctgcaccatatcgtcaccgagggctgggccatg
gacatcttcgcccgcgaactgggcgagctgtacgaggccttcgtcgatgaccgcgaatcg
ccgctggcgccgctgccagtgcagtacctggactacagcgtgtggcaacggcaatggctg
gaaagcggcgagggcgcccgccagctggcctactggcaggcccgcctgggcgatgagcac
ccagtgctggcgttgcctgccgaccgcccgcgcccggcagtgcagagccaccgtggcgag
ctgtaccgcttcgagctcgacccggcgctggttgcccgcgtgcatgccttcaacagccag
cgcggcctgaccctgttcatgaccatgactgccaccctggccgccttgctgcaccgctat
agcggccagcgtgacctgcgcattggcgcgccggtggccaaccgcatccgcccggaaagc
gaagggctgattggcgcgttcctcaacacccaggtgctgcgttgcgagctggacggccag
atgagcgccgcgcagttgctggagcaggtacgccaggttgctatcgaaggccagtcgcac
caggacctgccgttcgaccagctggtggaagccctgcagccaccgcgcagcagcgcctac
aacccgctgtaccaggtgatgtgcaacgttcagcgctgggccttccagcaaagccgccag
cttgccggcatgcaggtggattacctggtcaacgacgccagcgccaccaagttcgacctg
tacctggaggtgaccgacctcgacggccgcctgggttgctgtctgacctatagccgtgac
ctgttcgacgaaccacgcatcgcacgcatggccgagcactggcagcaattgctggtgggc
ctgctcgacaacccgcaacagcgcctgtgcgagctgccgatgctgagcagcgccgagcag
cagttgctggctggccagttgcagggcgagcagggtctcgctctcgaccagaccgtgcat
ggcctgttcgccgcccaggctgcgcgtacgccacacgctggcgcgttgaccttcgccggc
cggcacatgacctatgccgaactcgaccagcagaccaaccgcctggcccgcgccctgcgc
gagcgtggcgtcggcccgcaggtgcgtgtgggcctggcgctggagcgttcgctggaaatg
gtcgtcggcctgctggccatcctcaaggccggtggcgcctatgtgccgctcgaccccgaa
tacccgctcgaccgcctgcgctacatgattgaagacagccgcatcggcctgctgctcagc
cagcgcgcgctgctgcaaaccctcgggcagttgcccgaaggcgtggcgcactggagcctg
gaggacgacagcgccagcctgtcggcctacagcgatgcgccgctggacaacctcaacctg
ccgcagcaccaggcctacctgatctacacctccggttccaccggcaagcccaagggcgtg
gtagtcagccacggcgagttcgccatgcattgccaggcggtgatcgaggcgttcggcatg
cgcagcgatgactgcgagctgcacttctattcgatcaatttcgacgccgccagcgaacgc
ctgtgggtgccgctgctgtgtggcgcccgcgtggtgctgcgcgcccaggggcagtggggc
gccgaagacatctgccagctggtgcgcgagcagcaggtgagcattcttggcttcacgcca
agctacggcagccagttggcgcagtacctggccgggcagggcgagcagttgccagtgcgc
ctggtcattaccggtggtgaggcgctgaccggcgaacacttgcagcgcatccgccaagcc
tttgcgccgcagcagttcttcaacgcctacgggccgaccgaaaccgtggtcatgccgctg
gcctgcctggcaccacagacactgccggcggagctgggcagcgtaccgatcggccgcgtc
atcggtagccgcacggcctacatcctcgacgaagaccttgccctgttgccgcaaggcggt
attggcgagctgtatgtcggcggtgccggcctggcccagggttaccacgaccgcccgggc
ctaagcgccgagcgcttcgtcgccgacccgttcggcagcgaaggcgggcgcctgtatcgc
accggtgacctggtgcgcctgggcagcgatggcctggtcgagtacgtcggccgcgccgac
cagcaggtgaagattcgcggtttccgtatcgagctgggcgaaatcgaaagccgcctgcag
gcgcatgccgatatcgacgaagctgtggtgctggccctcgacctaccgggcggcaagcaa
ctggtaggttacctggtgtgcaggcaggccgctgccgacagcgaggcccagggcctgctg
cgcgacgcggtgaaagccgatgcccgcaagcacttgccggactacatggtgccggcgcac
ctggtgctgctcgacagcctgccgctgatgggcaacggcaagctcgaccgccgtgcgctg
ccgctgccggacctggaacaggcacgccagcagtaccaggcgcctggcaacgaggtggaa
gcgcaactggcgcagatctggcgcgacgtgctcaacgttgcccgggtcggcgtgcaggac
aacttcttcgaactgggcggcgactcgatcctgtcgatccaggtggtcagccgtgctcgt
caggccggcttgcagttcaccccgcgcgacctgttccagcatcagaccatccagaccctg
gccgccattgttcagcgcagcgaagccgccagcagcatcgaacagggcctgcgccagggc
caggccggcctcacgccgatccagcactggttcttcgacagtgaagtgccacagccgcag
cactggaaccaggctgttctgctggaggcacgcaagccgctggatgagggggtactgaag
cgagccttggccgacctggtgcagcaccacgacagcctgtgcctgcgctttggccaggcc
cagggccgctggcaggccgaatatgcttcgcctgccagcgggcagttactgtggacagcc
acggtcgccgacttcgccgattgccaaccgctgtacaccgacctgcaacgcagcctcaac
ctggaacagggcccactgttgcgcgccttgctggtaaatgacggccagggcggccagcgc
ctgttgctggctatccatcacttggtggtcgatggcgtgtcgtggcgcgtgctgctggaa
gacctgcaggcgctgtaccgtggccagccgctgccggccaagacccacgccatgggcgac
tgggccgcacgcctggccagctatgctggcagcgattcgctgcgcgacgagctgggctgg
tggcaaggccagttgggtggtgtgcgccgtgaactgccatgtgatcacccgcagggcggc
aacctgcaccgccacgcccgtaccctggccatcggcctggatgtggcgcagacccggcag
ttgctgcagcaggccccggcggcctatcacacccaggtcaacgacctgctgctgaccgcg
ctggcgcgtgccctgtgccgctggagcggcgatgaagaagtgctggtacagcttgagggc
catggccgtgacgggctgttcgaagacatggacctgacccgcagcgtcggctggttcacc
aacgcctacccgctgagcctgcgcccgctgccaggcgaggacgatgcggcgcgggcaggc
tcgatcaagcgcatcaaggagcagctgcgccaggtgccgcacaaagggctgggttacggc
gtgctgcgctacctggccgatacggcagtgcgtgagcagatggcggccctgccgcaggca
cgcatcaccttcaactacctgggccagttcgaccagcagttcgacagcacagccctgttc
cagccgctggacgccccggccggcctggcccacgacctcgatgcaccgctgcccaactgg
ctgagtgtcgatggccaggtgtatggcggtgccctgcaactgcgctggaccttcagtgcc
gaacgctacgacgagcggaccatcgcctgcctggccgaggcctatcgtcaggagctgctg
gcgctggtcgagcattgcctggctgatggcaacggcagtttcacgccatcggacttcccg
ctggcgcacctgacccaggcgcagatcgacgcgctgccggtaccggccgcgcagatcgag
gacgtttacccgctgacgccgatgcaggagggcatgctgttgcacaccctgctggagccg
ggtactggcctttactacatgcaggaccgctaccgcatcaacagcgcgctcgaccccgaa
cgcttcgcccaggcgtggcaggcggtggtggcacgccacgaggcgctacgcgcatcgttc
agctggaacaccggcgaggcgatgctgcagatcatccacaaaccgggcaacatgccggtg
gactatcaggactggcgtggcctcgacgacgacgtccaggagcagtgcctgcaggccctg
cacaagcaggaacgcgaggctggtttcgccctgctcagcgaggcgccgttccacctgcgc
ctggtgcgtgtggccgacgagcgctactggttcatgatgagcaaccaccacatcctcatc
gatgcctggtgccgttcgctgttgatgaacgatttcttcgagatctaccaggccctcggc
gaggggcgccaggcccgcttgccggtgccaccgcgctaccgcgactacatcggctggctg
caacgccagggcctggacgacgcgcgagcctggtggcaggccaacctggccggcttcgaa
cgcgccaccacgatccccagcgaccgcccgctgcgccacgaccatgccggtagcggcatg
atcgtcggcgactgttacacccgcctggcgttgagcgacggcgtgcgcttgcgcgaactg
gcccaggcccaccagctcaccgtcaacaccttcgcccaggcggcctgggcactggtgctg
gcgcgctacagtggcgaccgcgacgtggcctttggcgtgaccgtggccgggcgcccggtg
agcatgccgcagatgcagcgtaccgtcggcctgttcatcaacagcgtcgccctgcgcgtg
caattgccggtagcgggtgagcgctgcagtgtgcgccagtggttgcaaggcctgctggag
cgcaacatggaactgcgcgaatatgaatacctgccgctggtggcgatccaggaatgcagc
gaactgcccaagggccagccgctgttcgacagcctgttcgtgttcgagaacgcgccggtg
gaaactgccgtgctcgaccacgcccagcacctgaatgccagctccgactcgggccgtacc
cacaccaacttcccgctgacagcggtgtgctacccgggcgatgaccttggcctgcacctg
tcgttcgaccagcgctatttcgactacccgaccgtcgagcgcctgctggccgagttcaag
cgcctgctgctggcgctggtgcaaggctttgaaggggagatgagcgcactgccgttgctg
ggtgcggaagagcagcgcttcctgctggaagactgcaaccgcaccgcgcgcgcctatccg
ttggaacagagttacatcgcgcagttcgaggcgcaggtggccgcgcatccgcaacgtacc
gtggcccgctgcctggacgcgtcctacgactacgccggcttgaacctggcggccaaccgt
ctgggccatgccttgatcgcggcgggtgtgagcgtggaccagccggtggcactgctggcc
gcgcgtgggctaccgctgctgggcatgatcgtcggcagcttcaaggccggcgccggctac
ctgccactggacccgggcctgccggcggcgcgcctgcaaagcatcatccagctcagccgt
acacccgtgctggtgtgcagcgcggcctgtgccgggcaagggcggcagttgctggaccag
cttgcgttggcagcacggcctcagctgctggtctgggaagacatccaggccagcccggtg
gccagccacaaccccggcattcacagcgggccggataacctcgcctatgtgatctacacc
tcaggctccaccggcctgccgaagggggtgatggtcgagcagcgcggcatgctcaacaac
cagctgagcaaggtgccttacctggcgctcggcgagcacgacgtgatcgcccagacggcc
tcgcagagcttcgacatttcggtgtggcagttccttgccgcaccgctgttcggcgccagg
gtggagatcgtgccgaacgccatcgcccatgacccgcagggcctgttggcgcatgtgcag
gccaccggcatcagcgtgctggagagcgtgccgtcgctgatccagggcatgctggccaac
ggccatcaggccctcgaaggcctgcgctggatgctgccgaccggcgaagccatgccaccg
gagctggcggcgcagtggttgcagcgctacccgcagatcggcctggtcaacgcctacggc
ccggcggagtgctccgatgacgtggcgttcttccgcgtcgatgcagcctcgacccgtggc
agctacctgccgatcggcacgccgaccgacaataaccgcctgtatctgtacggcgaggac
cagacgctggtaccactgggtgcgacaggtgagttgtgcgtggccggcaccggcgtgggc
cgtggctatgtcggcgacccggtgcgcacggcgctggcgttcattccccatcctcatggt
gcgccgggcgaacgcctgtatcgcactggcgacctggcgcggcagcgcccggacggggtg
ctggagtatgtcgggcgcatcgaccatcaggtgaagattcgcggctaccgcatcgaactg
ggcgaaatcgaagcccgcctgcacgaacagccggagatccgcgacgctgccgttggcgtg
caggagggcgtcaatggcaagcacctggtgggttacctggtggcgcatcagggcgttgca
gccgacgctgcgttgctggaacagctcaagctgcgcctgcgtgccgagttgccggagtac
atggtgccactgcactggggctggttcgacagcctgccgcacaacgccaacggcaagctc
gaccgcaaggccttgccggccatcgacatcggtggccagcacagccaggcctaccaggcg
ccgcgcaatgagctggaagaggtactggccggtatctgggcggatgtgctcaaggccgac
cgggtcggggtgcacgacaacttcttcgagctgggcgggcattcgctgctggccacgcag
atcgcctcgcgggtgcagaagcagctgcaactgaacgtgccgctgcgggcgatgttcgag
tgcagcacggtggaggagctggcggtgtatgtgcaggggctgcagggcagtgtgctggat
gacgacaaggtcgaccggctcagtgacctgatggccgagctggaggggttgtga

DBGET integrated database retrieval system