KEGG   Pandoraea pnomenusa RB38: DA70_10980Help
Entry
DA70_10980        CDS       T03067                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
ppno  Pandoraea pnomenusa RB38
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppno00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DA70_10980
Enzymes [BR:ppno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     DA70_10980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2440072..2441364)
Genome map
AA seq 430 aa AA seqDB search
MNRTLSATYLIETPLDPEQVAEVMAGEQSCGTFTRVAGETDALRARARATVESVERVGEA
SRASLPNAFLDRLAATDPRAGNGPWHRARVRIAFPCDNVGANLPTLAATLAGNLYDLGEV
TGMRLERVAMPSAYRRQFDFPRYGIDGTRRATGVAQGALVGTILKPNVGMRADETAALVS
RLCDAGVDFIKDDEVCANPVHAPLAERVPAVMAAVRAHRERTGKQVMVAFNITDETGEML
RHADLVQREGGNCVMVSLNWCGFSAVTTLRRHTPLAIHGHRNGYGAMSRDPMLGIGFQAY
QALWRLAGVDHMHVHGLQGKFAQPDDEVIESALDCYAPLCVDAGDGPDDRVMPAFSSGQW
AGTVPATWQALGRDDLLFMAGGGILAHPDGAGAGVQSLRDAWQAMRAGQSLDEAASHAPA
LAAAVRFFGR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggacactgagtgcgacatacctgatcgagacgccgctcgacccggagcaggtc
gccgaagtcatggccggcgagcagtcctgcggcaccttcacccgggtggcgggcgagaca
gatgcgttgcgcgcccgtgcccgcgccacggtcgagtctgtcgagcgggtgggcgaggcc
tcgcgcgcgtcgttgccgaacgcctttctcgatcgtctggccgcgacggacccgagagcg
ggcaatggaccgtggcatcgcgcacgggtgcgcatcgcgtttccgtgcgacaacgtcggg
gcgaatctgccgacgctggccgccacgctggcgggcaacctgtacgacctgggggaagtg
acgggcatgcgcctggagcgcgttgcgatgccgtcggcctatcgtcggcaattcgatttc
ccgcgctacggcatcgatggcacgcgccgggccacgggcgtggcacagggtgcgctcgtc
ggcacgatcctcaagcccaacgtcggcatgcgcgccgacgagacggccgcgctcgtttcg
cgcctgtgcgacgcgggcgtcgacttcatcaaggatgacgaggtgtgcgccaaccccgtg
catgcgccgttggccgagcgcgtgccggcggtcatggcggcagtgcgcgcgcaccgcgaa
cgcacgggcaagcaggtgatggtggccttcaacatcacggacgagaccggagagatgctg
cgtcacgccgacctcgtgcaacgcgaggggggcaattgcgtgatggtcagtctgaactgg
tgcggcttttcggcggtcacgacgctgcgtcgacatacgccgctggcgatccacggccat
cggaacggctacggcgccatgtcgcgcgacccgatgctaggcatcggcttccaggcctat
caggcgctctggcggctcgcgggcgtggatcacatgcacgtgcacggtctgcaaggcaag
ttcgcgcagcccgatgacgaggtcatcgaatccgcgcttgattgctatgccccgctttgc
gtcgatgcgggcgacggcccggacgatcgcgtcatgcccgctttttcttccggtcagtgg
gccggcacggtgcccgcgacctggcaggcgttggggcgcgacgacctgctcttcatggcg
gggggcggcatacttgcgcatcccgacggggcgggcgccggcgtgcagagcctgcgcgac
gcgtggcaggcgatgcgcgccgggcagtcgctcgatgaagcggcatcccatgcgcccgcg
ctggccgccgccgtgcgcttcttcgggcgctga

DBGET integrated database retrieval system