KEGG   Paenibacillus polymyxa M1: PPM_4046Help
Entry
PPM_4046          CDS       T01968                                 

Gene name
npr
Definition
(GenBank) neutral protease
  KO
K01400  
bacillolysin [EC:3.4.24.28]
Organism
ppo  Paenibacillus polymyxa M1
Brite
Enzymes [BR:ppo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     PPM_4046 (npr)
Peptidases [BR:ppo01002]
 Metallo Peptidases
  Family M4: thermolysin family
   PPM_4046 (npr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
4673093..4674871
Genome map
AA seq 592 aa AA seqDB search
MKKVWVSLLGGAMLLGSVASGASAESSVSGPAQLTPTFHAEQWKAPTSVSGDDIVWSYLN
RQKKSLLGVDSSSVREQFRIVDRTSDKSGVSHYRLKQYVNGIPVYGAEQTIHVGKSGEVT
SYLGAVVNEDQQAEATQGTTPKISASEAVYTAYKEAAARIEALPTSDDTISKDAEEPSSV
SKDTYAEAANNEKTLSVDKDELSLDQASVLKDSKIEAVEPEKSSIAKIANLQPEVDPKAE
LYYYPKGDDLLLVYVTEVNVLEPAPLRTRYIIDANDGSIVFQYDIINEATGTGKGVLGDS
KSFTTTASGSSYQLKDTTRGNGIVTYTASNRQSIPGTILTDADNVWNDPAGVDAHAYAAK
TYDYYKAKFGRNSIDGRGLQLRSTVHYGSRYNNAFWNGSQMTYGDGDGSTFIAFSGDPDV
VGHELTHGVTEYTSNLEYYGESGALNEAFSDVIGNDIQRKNWLVGDDIYTPNIAGDALRS
MSNPTLYDQPDHYSNLYRGSSDNGGVHTNSGIINKAYYLLAQGGNFHGVTVNGIGRDAAV
QIYYSAFTNYLTSSSDFSNARAAVIQAAKDLYGANSAEATAAAKSFDAVGVN
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtatgggtttcgcttcttggaggagctatgttattagggtctgtcgcgtct
ggtgcatctgcggagagttccgtttcggggccagctcagcttacaccgaccttccacgcc
gagcaatggaaagcacctacctcggtatcgggggatgacattgtatggagctatttaaat
cgacaaaagaaatcgttgctgggtgtggatagctccagtgtacgtgaacaattccgaatc
gttgatcgcacaagcgacaaatccggtgtaagccattatcgactgaagcagtatgtaaac
ggaattcccgtgtatggagctgaacaaactattcatgtgggcaaatctggtgaggtcacc
tcttacttaggagcggtggttaatgaggatcagcaggcagaagctacgcaaggtacaact
ccaaaaatcagcgcttctgaagcggtctacaccgcatataaagaagcagctgcacggatt
gaagccctccctacctccgacgatactatttctaaagacgctgaggagccaagcagtgta
agtaaagatacttacgccgaagcagctaacaacgaaaaaacgctttctgttgataaggac
gagctgagtcttgatcaggcatctgtcctgaaagatagcaaaattgaagcagtggaacca
gaaaaaagttccattgccaaaatcgctaatctgcagcctgaagtagatcctaaagcagaa
ctctactactaccctaagggggatgacctgctgctggtttatgtaacagaagttaatgtt
ttagaacctgccccactgcgtacccgctacattattgatgccaatgacggcagcatcgta
ttccagtatgacatcattaatgaagcgacaggcacaggtaaaggtgtgcttggtgattcc
aaatcgttcactactaccgcttccggcagtagctaccagttaaaagatacaacacgcggt
aacggaatcgtgacttacacggcctccaaccgtcaaagcatcccaggtaccattttgaca
gatgccgataatgtatggaatgatccagctggtgtggacgcccatgcgtatgctgctaaa
acctatgattactataaagccaaatttggacgcaacagcattgacggacgcggtctgcaa
cttcgttcgacggtccattacggtagtcgctacaacaatgccttctggaacggctcccaa
atgacttatggagatggagatggtagcacatttatcgccttcagcggggaccccgatgta
gtaggacatgaacttacgcatggtgtcacagagtatacttcgaatttggaatattacgga
gagtccggcgcattgaatgaagctttctcagacgttatcgggaatgacattcagcgcaaa
aactggcttgtaggcgatgatatttacacgccaaacattgcaggcgatgcccttcgctca
atgtccaatccaaccctgtacgatcaaccagatcactattccaacctgtacagaggcagc
tccgataacggcggtgttcacaccaacagcggtattatcaataaagcttactacttgtta
gcacaaggtggtaatttccatggcgtaactgtaaatggaattggccgtgatgcagcggtg
caaatttactacagtgcctttacgaactacctgacttcttcttccgacttctccaacgca
cgtgctgctgtgatccaagccgcaaaagatctgtacggggcgaactcagcagaagcaact
gcagctgccaagtcttttgacgctgtaggcgtaaactaa

DBGET integrated database retrieval system