KEGG   Paenibacillus polymyxa Sb3-1: RE92_14810Help
Entry
RE92_14810        CDS       T03812                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ppoy  Paenibacillus polymyxa Sb3-1
Brite
Translation factors [BR:ppoy03012]
 Eukaryotic Type
  Elongation factors
   RE92_14810 (tuf)
 Prokaryotic Type
   RE92_14810 (tuf)
Mitochondrial biogenesis [BR:ppoy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    RE92_14810 (tuf)
Exosome [BR:ppoy04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   RE92_14810 (tuf)
  Exosomal proteins of breast cancer cells
   RE92_14810 (tuf)
  Exosomal proteins of colorectal cancer cells
   RE92_14810 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AJE52241
UniProt: A0A0F0FWI3
LinkDB All DBs
Position
3371560..3372750
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHVNIGTIGHVDHGKTTLTAAITTVLSKTYGGAAVAFDQIDKAPEERERG
ITISTAHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKCDMVEDEELLELVEMEVRDLLSEYDFPGDDTPITRGSAREALQ
NPDGDWAKKIVEMFETIDTYIPTPERDTDKPFLMPVEDVFSITGRGTVATGRVERGTVKV
GDEIEIIGIQEESRKSVVTGVEMFRKLLDSAQAGDNIGALLRGVDRAQIERGQVLAKPGS
VNPHTEFSAQIYVLTKEEGGRHKPFFTGYRPQFYFRTTDVTGIITLPEGSEMVMPGDNIT
VTVQLISPIAIEEGTKFSIREGGRTVGAGAVATISK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggctaagtttgaacgtaacaaaccgcacgttaatatcggtacaattggtcac
gtcgatcatggtaaaacaactttgactgctgcaatcacaactgtactttccaaaacttac
ggtggtgctgctgtagcattcgatcaaatcgataaagctccagaagagcgcgaacgcggt
atcacaatctccactgcacacgtggaatacgaaacacctaaccgtcactatgcacacgtt
gactgcccaggtcacgccgactatgttaaaaacatgatcactggcgctgcacaaatggac
ggagcgattctggttgtatccgcagctgacggtcctatgccgcaaactcgcgaacacatc
ctcttgtcccgtcaagtaggtgttccatacatcgttgtattcctgaacaaatgcgacatg
gttgaagacgaagagttgctggaattggttgaaatggaagttcgcgacttgctgagcgag
tatgacttcccaggcgacgacactccaatcactcgtggttccgctcgtgaagcactgcaa
aacccagatggcgactgggctaagaaaatcgttgaaatgttcgaaacaatcgacacttac
atcccaactccagaacgcgacactgacaagcctttccttatgcctgtcgaggacgtattc
tccatcactggtcgtggtacagttgctacaggccgtgtagagcgtggtactgttaaagtg
ggcgacgaaatcgaaatcatcggtattcaagaagaatcccgtaaatccgtagtaacaggc
gtagaaatgttccgtaaattgcttgactccgctcaagctggtgacaacatcggcgcactg
cttcgcggtgtagatcgtgcacaaatcgagcgtggccaagtattggctaaaccaggttct
gttaacccacatacagaattctctgctcaaatctacgttttgactaaagaagaaggcgga
cgtcacaaacctttcttcactggttaccgtccacagttctacttccgtacaactgacgta
actggtatcattactctgccagaaggttccgaaatggtaatgcctggtgataacattacg
gttactgttcaactgatcagcccaatcgcgattgaagaaggaactaagttctccattcgt
gaaggtggacgtacagttggtgcaggcgctgtagcaacaatctccaaataa

DBGET integrated database retrieval system